Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.51
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.3e-44

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 1.3e-44

Synonym

Accession Q96IR7 B2R9B0
Symbols GLOXD1
4-HPPD-L

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
21294693 This study shows that only the GLO1 C-7T polymorphism, and not the GLO1 A419C and ALR C-106T polymorphisms, is associated with carotid atherosclerosis in Chinese patients with type 2 diabetes.

AA Sequence

MAAPALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLD      1 - 70
PRHAVPSATNLCFDVADAGAATRELAALGCSVPVPPVRVRDAQGAATYAVVSSPAGILSLTLLERAGYRG     71 - 140
PFLPGFRPVSSAPGPGWVSRVDHLTLACTPGSSPTLLRWFHDCLGFCHLPLSPGEDPELGLEMTAGFGLG    141 - 210
GLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQF    211 - 280
LAPPGAYYQQPGKERQIRAAGHEPHLLARQGILLDGDKGKFLLQVFTKSLFTEDTFFLELIQRQGATGFG    281 - 350
QGNIRALWQSVQEQSARSQEA                                                     351 - 371
//

Text Mined References (6)

PMID Year Title
21294693 2011 Glyoxalase I and aldose reductase gene polymorphisms and susceptibility to carotid atherosclerosis in type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.