Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.40
PubTator Score 1.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -3.600 1.3e-02
posterior fossa group A ependymoma -4.000 4.2e-14
oligodendroglioma -2.700 2.6e-18
glioblastoma -4.600 3.0e-06
medulloblastoma -5.500 7.2e-12
atypical teratoid / rhabdoid tumor -4.400 1.5e-07
medulloblastoma, large-cell -5.300 6.7e-09
primitive neuroectodermal tumor -3.700 1.2e-03
adult high grade glioma -4.400 3.8e-08
pilocytic astrocytoma -4.000 2.5e-11
subependymal giant cell astrocytoma -4.799 4.6e-03
Pick disease -1.400 1.4e-02
pituitary cancer 1.700 3.9e-03

Synonym

Accession Q9UM19 B2R5U2 D3DPU1 Q5TG97 Q8N611 HLP4
Symbols HLP4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR      1 - 70
TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM     71 - 140
NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK                       141 - 191
//

Text Mined References (16)

PMID Year Title
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10520747 1998 Isolation of two human cDNAs, HLP3 and HLP4, homologous to the neuron-specific calcium-binding protein genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.