1. Home
  2. Targets
  3. Hippocalcin-like protein 4

Tdark Hippocalcin-like protein 4

May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.

The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

 Comments

Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.40
PubTator Score 1.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -3.600 1.3e-02
posterior fossa group A ependymoma -4.000 4.2e-14
oligodendroglioma -2.700 2.6e-18
glioblastoma -4.600 3.0e-06
medulloblastoma -5.500 7.2e-12
atypical teratoid / rhabdoid tumor -4.400 1.5e-07
medulloblastoma, large-cell -5.300 6.7e-09
primitive neuroectodermal tumor -3.700 1.2e-03
adult high grade glioma -4.400 3.8e-08
pilocytic astrocytoma -4.000 2.5e-11
subependymal giant cell astrocytoma -4.799 4.6e-03
Pick disease -1.400 1.4e-02
pituitary cancer 1.700 3.9e-03

Synonym

Accession Q9UM19 B2R5U2 D3DPU1 Q5TG97 Q8N611 HLP4
Symbols HLP4

Gene

HPCAL4

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (7)

 GO Function (2)

 GO Component (1)

 GO Process (2)

 Compartment GO Term (5)

 IMPC Phenotype (1)

 MGI Phenotype (1)

 HCA RNA Cell Line (43)

See all...

Pathway (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence 

MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR      1 - 70
TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM     71 - 140
NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK                       141 - 191
//

Text Mined References (16)

PMID Year Title
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10520747 1998 Isolation of two human cDNAs, HLP3 and HLP4, homologous to the neuron-specific calcium-binding protein genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.