Property Summary

NCBI Gene PubMed Count 20
PubMed Score 18.86
PubTator Score 8.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 3.5e-03
Disease Target Count Z-score Confidence
Polydactyly 93 4.269 2.1
Syndactyly 56 4.231 2.1
Clubfoot 35 3.095 1.5

Gene RIF (7)

PMID Text
20085705 In human embryonic stem cell (hESCs)differentiation, a 1.8kb region between HOXD11 and HOXD12 (D11.12) that is associated with PcG proteins was discovered, it shows alteration in nuclease sensitivity as hESCs differentiate.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19540081 data show no significant difference in HOXD11, HOXD12 & HOXD13 genotype frequencies between the autism spectrum disorder & healthy controls, but one SNP in promoter region of HOXD11 was observed in only 4 patients with ASD
19540081 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
16331564 Data show that HOXD12 are important susceptible genes of idiopathic congenital talipes equinovarus.
16331564 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCAPAQPAGATAFG      1 - 70
GFSQPYLAGSGPLGLQPPTAKDGPEEQAKFYAPEAAAGPEERGRTRPSFAPESSLAPAVAALKAAKYDYA     71 - 140
GVGRATPGSTTLLQGAPCAPGFKDDTKGPLNLNMTVQAAGVASCLRPSLPDGLPWGAAPGRARKKRKPYT    141 - 210
KQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLREQALALY              211 - 270
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20085705 2010 A region of the human HOXD cluster that confers polycomb-group responsiveness.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19540081 2010 Study of HOXD genes in autism particularly regarding the ratio of second to fourth digit length.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
17236141 2007 Mutations in HOXD13 underlie syndactyly type V and a novel brachydactyly-syndactyly syndrome.
16331564 2005 [Analysis of association between 5' HOXD gene and idiopathic congenital talipes equinovarus].
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12357469 2002 Limb malformations and the human HOX genes.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11778160 2002 A 117-kb microdeletion removing HOXD9-HOXD13 and EVX2 causes synpolydactyly.
11060466 2000 Clustering of two fragile sites and seven homeobox genes in human chromosome region 2q31-->q32.1.
11036080 2001 A set of Hox proteins interact with the Maf oncoprotein to inhibit its DNA binding, transactivation, and transforming activities.
10364522 1999 Monodactylous limbs and abnormal genitalia are associated with hemizygosity for the human 2q31 region that includes the HOXD cluster.
9343407 1997 AbdB-like Hox proteins stabilize DNA binding by the Meis1 homeodomain proteins.
9323126 1997 Molecular models for vertebrate limb development.
2574852 1989 The human HOX gene family.
1973146 1990 Nomenclature for human homeobox genes.
1675198 1991 EVX2, a human homeobox gene homologous to the even-skipped segmentation gene, is localized at the 5' end of HOX4 locus on chromosome 2.
1358459 1992 Vertebrate homeobox gene nomenclature.