Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.05
PubTator Score 8.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Limb Deformities, Congenital 16 0.0 0.0
Melanoma 711 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.5e-03
Disease Target Count Z-score Confidence
Polydactyly 107 4.254 2.1
Syndactyly 88 4.239 2.1
Clubfoot 39 3.044 1.5

Gene RIF (7)

AA Sequence

MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCAPAQPAGATAFG      1 - 70
GFSQPYLAGSGPLGLQPPTAKDGPEEQAKFYAPEAAAGPEERGRTRPSFAPESSLAPAVAALKAAKYDYA     71 - 140
GVGRATPGSTTLLQGAPCAPGFKDDTKGPLNLNMTVQAAGVASCLRPSLPDGLPWGAAPGRARKKRKPYT    141 - 210
KQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLREQALALY              211 - 270
//

Text Mined References (22)

PMID Year Title