Property Summary

NCBI Gene PubMed Count 24
PubMed Score 36.27
PubTator Score 21.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.300 1.7e-03
lung cancer 1.600 1.1e-03
osteosarcoma 1.811 4.9e-02
psoriasis 2.700 2.7e-29

Gene RIF (11)

AA Sequence

MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLER      1 - 70
AKWPYRGGGGGGSAGGGSSGGGPGGGGGGAGGYAPYYAAAAAAAAAAAAAEEAAMQRELLPPAGRRPDVL     71 - 140
FKAPEPVCAAPGPPHGPAGAASNFYSAVGRNGILPQGFDQFYEAAPGPPFAGPQPPPPPAPPQPEGAADK    141 - 210
GDPRTGAGGGGGSPCTKATPGSEPKGAAEGSGGDGEGPPGEAGAEKSSSAVAPQRSRKKRCPYTKYQIRE    211 - 280
LEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLNRDRLQYFTGNPLF                281 - 338
//

Text Mined References (25)

PMID Year Title