Property Summary

NCBI Gene PubMed Count 47
PubMed Score 45.39
PubTator Score 47.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.100 5.7e-03
glioblastoma 1.400 3.9e-03
osteosarcoma 2.617 1.7e-02
medulloblastoma, large-cell 1.100 1.0e-04
adrenocortical carcinoma 1.904 2.1e-03
non-small cell lung cancer 1.104 1.5e-06
lung cancer 3.900 6.6e-07
active ulcerative colitis -1.540 1.0e-02
interstitial cystitis -1.100 3.6e-02
adult high grade glioma 2.100 1.4e-04
ovarian cancer -2.900 7.8e-11
Gaucher disease type 3 -2.600 3.4e-02

Gene RIF (22)

PMID Text
26311318 Low HOXD10 promotes migration and invasion in gastric cancer.
26260613 These results suggested that HOXD10 may be a putative suppressor gene and can act as a prognostic marker and potentially a novel therapeutic target for cholangiocellular carcinoma.
25301728 POU2F1 activity regulates HOXD10 and HOXD11 gene expression in head and neck squamous cell carcinoma, promoting a proliferative and invasive phenotype.
25081374 Downregulation of the HOXD10 gene expression was associated with breast cancer.
25010866 HOXD10 expression varies by stage of disease and produces differential effects in head and neck squamous cell carcinoma.
24573354 KLF4 and HOXD10 were identified as direct targets of miR-10b in bladder cancer cells
24376640 MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration.
24305689 miR-23a was upregulated in glioma. This overexpression promoted glioma cell invasion, probably by modulating MMP-14 via directly inhibiting the expression of HOXD10.
24219032 It is a member of the HOX gene family. HOX genes are the main regulatory genes that directly influence organogenesis and maintain the function of differentiated tissues
23670532 downregulation of HOXD10 expression by miR-10b overexpression may induce an increase of pro-metastatic gene products, such as MMP14 and RHOC, and contribute to the acquisition of metastatic phenotypes in epithelial ovarian cancer cells
22842189 TBX1 can alter TGF-beta/BMP, an important signaling pathway, through interacting with HOXD10. Above findings may shed light on the mechanism of TBX1 mutations leading to renal malformations found in patients carrying a 22q11 deletion.
22293682 Suggest that miR-10b can stimulate the upregulation of RhoC and AKT phosphorylation through targeting HOXD10, thus promoting cell invasion in gastric tumors.
22160393 HoxD10 potentially functions as a tumor suppressor that is inactivated through promoter hypermethylation in gastric cancer.
21419107 miR-10b induced glioma cell invasion by modulating tumor invasion factors MMP-14 and uPAR expression via the direct target HOXD10
19453261 Observational study of gene-disease association. (HuGE Navigator)
18922890 Pak1 is a target of miR-7 and that HoxD10 plays a regulatory role in modifying the expression of miR-7.
17417092 Observational study of gene-disease association. (HuGE Navigator)
17417092 No evidence was found of linkage near the HOXD gene cluster on chromosome 2q, suggesting genes other than HOXD10 are responsible for idiopathic clubfoot.
16331564 Observational study of gene-disease association. (HuGE Navigator)
15368082 An autosomal-dominant-inherited mutation in a HOXD10 gene with complete penetrance is found in all members of a pedigree with congenital vertical talus.
15146389 Missense Mutation in HOXD10 is associated with congenital vertical talus and Charcot-Marie-Tooth disease
12466126 results indicate a role for HoxD10 in maintaining a nonangiogenic state in the endothelium

AA Sequence

MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMN      1 - 70
VHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCP     71 - 140
VENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEP    141 - 210
TKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLE    211 - 280
LEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS              281 - 340
//

Text Mined References (47)

PMID Year Title
26311318 2015 MicroRNA-10b promotes migration and invasion through Hoxd10 in human gastric cancer.
26260613 2015 HOXD10 acts as a tumor-suppressive factor via inhibition of the RHOC/AKT/MAPK pathway in human cholangiocellular carcinoma.
25301728 2014 POU2F1 activity regulates HOXD10 and HOXD11 promoting a proliferative and invasive phenotype in head and neck cancer.
25081374 2014 HOXD10 expression in human breast cancer.
25010866 2014 The roles of HOXD10 in the development and progression of head and neck squamous cell carcinoma (HNSCC).
24573354 2014 MicroRNA-10b promotes migration and invasion through KLF4 and HOXD10 in human bladder cancer.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24376640 2013 MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration.
24305689 2013 Targeting microRNA-23a to inhibit glioma cell invasion via HOXD10.
24219032 2014 miR-224 promotion of cell migration and invasion by targeting Homeobox D 10 gene in human hepatocellular carcinoma.
23670532 2013 Loss of HOXD10 expression induced by upregulation of miR-10b accelerates the migration and invasion activities of ovarian cancer cells.
22842189 2014 Interaction between Tbx1 and Hoxd10 and connection with TGF?-BMP signal pathway during kidney development.
22293682 2012 miR-10b promotes cell invasion through RhoC-AKT signaling pathway by targeting HOXD10 in gastric cancer.
22160393 2012 Homeobox D10 gene, a candidate tumor suppressor, is downregulated through promoter hypermethylation and associated with gastric carcinogenesis.
21419107 2011 MicroRNA-10b induces glioma cell invasion by modulating MMP-14 and uPAR expression via HOXD10.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18922890 2008 MicroRNA-7, a homeobox D10 target, inhibits p21-activated kinase 1 and regulates its functions.
17417092 2007 Absence of HOXD10 mutations in idiopathic clubfoot and sporadic vertical talus.
17236141 2007 Mutations in HOXD13 underlie syndactyly type V and a novel brachydactyly-syndactyly syndrome.
16331564 2005 [Analysis of association between 5' HOXD gene and idiopathic congenital talipes equinovarus].
16103068 2005 Homeobox D10 induces phenotypic reversion of breast tumor cells in a three-dimensional culture model.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15368082 2004 Congenital vertical talus in four generations of the same family.
15146389 2004 A HOX gene mutation in a family with isolated congenital vertical talus and Charcot-Marie-Tooth disease.
14973489 2004 The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions.
12954737 2004 HOXC and HOXD gene expression in human endometrium: lack of redundancy with HOXA paralogs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466126 2002 Sustained expression of homeobox D10 inhibits angiogenesis.
12357469 2002 Limb malformations and the human HOX genes.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11778160 2002 A 117-kb microdeletion removing HOXD9-HOXD13 and EVX2 causes synpolydactyly.
11585930 2001 The HOX homeodomain proteins block CBP histone acetyltransferase activity.
11060466 2000 Clustering of two fragile sites and seven homeobox genes in human chromosome region 2q31-->q32.1.
10523646 1999 PBX and MEIS as non-DNA-binding partners in trimeric complexes with HOX proteins.
10364522 1999 Monodactylous limbs and abnormal genitalia are associated with hemizygosity for the human 2q31 region that includes the HOXD cluster.
9773404 Expression of HOXD10 gene in normal endometrium and endometrial adenocarcinoma.
8100684 1993 Autosomal dominant tetramelic postaxial oligodactyly.
7967520 1994 Expression of AbdB-type homeobox genes in human tumors.
7913891 1994 The thyroid transcription factor-1 gene is a candidate target for regulation by Hox proteins.
2576652 1989 Organization of human class I homeobox genes.
2574852 1989 The human HOX gene family.
1981366 1990 Expression of HOX homeogenes in human neuroblastoma cell culture lines.
1973146 1990 Nomenclature for human homeobox genes.
1756725 1991 HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities.
1363084 1992 Why we have (only) five fingers per hand: hox genes and the evolution of paired limbs.
1358459 1992 Vertebrate homeobox gene nomenclature.
1351871 1992 Human HOX4E: a gene strongly expressed in the adult male and female urogenital tracts.