| Tbio | Homeobox protein Hox-D10 |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| ovarian cancer | 8491 | 7.8e-11 |
| lung cancer | 4473 | 6.6e-07 |
| non-small cell lung cancer | 2798 | 1.5e-06 |
| medulloblastoma, large-cell | 6234 | 1.0e-04 |
| adult high grade glioma | 2148 | 1.4e-04 |
| adrenocortical carcinoma | 1427 | 2.1e-03 |
| glioblastoma | 5572 | 3.9e-03 |
| psoriasis | 6685 | 5.7e-03 |
| active ulcerative colitis | 477 | 1.0e-02 |
| osteosarcoma | 7933 | 1.7e-02 |
| Gaucher disease type 3 | 76 | 3.4e-02 |
| interstitial cystitis | 2299 | 3.6e-02 |
| Disease | Target Count |
|---|---|
| Vertical talus, congenital | 1 |
| Disease | log2 FC | p |
|---|---|---|
| psoriasis | -1.100 | 5.7e-03 |
| glioblastoma | 1.400 | 3.9e-03 |
| osteosarcoma | 2.617 | 1.7e-02 |
| medulloblastoma, large-cell | 1.100 | 1.0e-04 |
| adrenocortical carcinoma | 1.904 | 2.1e-03 |
| non-small cell lung cancer | 1.104 | 1.5e-06 |
| lung cancer | 3.900 | 6.6e-07 |
| active ulcerative colitis | -1.540 | 1.0e-02 |
| interstitial cystitis | -1.100 | 3.6e-02 |
| adult high grade glioma | 2.100 | 1.4e-04 |
| ovarian cancer | -2.900 | 7.8e-11 |
| Gaucher disease type 3 | -2.600 | 3.4e-02 |
| PMID | Text | |
|---|---|---|
| 26311318 | Low HOXD10 promotes migration and invasion in gastric cancer. | |
| 26260613 | These results suggested that HOXD10 may be a putative suppressor gene and can act as a prognostic marker and potentially a novel therapeutic target for cholangiocellular carcinoma. | |
| 25301728 | POU2F1 activity regulates HOXD10 and HOXD11 gene expression in head and neck squamous cell carcinoma, promoting a proliferative and invasive phenotype. | |
| 25081374 | Downregulation of the HOXD10 gene expression was associated with breast cancer. | |
| 25010866 | HOXD10 expression varies by stage of disease and produces differential effects in head and neck squamous cell carcinoma. | |
| 24573354 | KLF4 and HOXD10 were identified as direct targets of miR-10b in bladder cancer cells | |
| 24376640 | MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration. | |
| 24305689 | miR-23a was upregulated in glioma. This overexpression promoted glioma cell invasion, probably by modulating MMP-14 via directly inhibiting the expression of HOXD10. | |
| 24219032 | It is a member of the HOX gene family. HOX genes are the main regulatory genes that directly influence organogenesis and maintain the function of differentiated tissues | |
| 23670532 | downregulation of HOXD10 expression by miR-10b overexpression may induce an increase of pro-metastatic gene products, such as MMP14 and RHOC, and contribute to the acquisition of metastatic phenotypes in epithelial ovarian cancer cells | |
| 22842189 | TBX1 can alter TGF-beta/BMP, an important signaling pathway, through interacting with HOXD10. Above findings may shed light on the mechanism of TBX1 mutations leading to renal malformations found in patients carrying a 22q11 deletion. | |
| 22293682 | Suggest that miR-10b can stimulate the upregulation of RhoC and AKT phosphorylation through targeting HOXD10, thus promoting cell invasion in gastric tumors. | |
| 22160393 | HoxD10 potentially functions as a tumor suppressor that is inactivated through promoter hypermethylation in gastric cancer. | |
| 21419107 | miR-10b induced glioma cell invasion by modulating tumor invasion factors MMP-14 and uPAR expression via the direct target HOXD10 | |
| 19453261 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18922890 | Pak1 is a target of miR-7 and that HoxD10 plays a regulatory role in modifying the expression of miR-7. | |
| 17417092 | Observational study of gene-disease association. (HuGE Navigator) | |
| 17417092 | No evidence was found of linkage near the HOXD gene cluster on chromosome 2q, suggesting genes other than HOXD10 are responsible for idiopathic clubfoot. | |
| 16331564 | Observational study of gene-disease association. (HuGE Navigator) | |
| 15368082 | An autosomal-dominant-inherited mutation in a HOXD10 gene with complete penetrance is found in all members of a pedigree with congenital vertical talus. | |
| 15146389 | Missense Mutation in HOXD10 is associated with congenital vertical talus and Charcot-Marie-Tooth disease | |
| 12466126 | results indicate a role for HoxD10 in maintaining a nonangiogenic state in the endothelium |
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMN 1 - 70 VHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCP 71 - 140 VENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEP 141 - 210 TKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLE 211 - 280 LEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS 281 - 340 //
| PMID | Year | Title | |
|---|---|---|---|
| 26311318 | 2015 | MicroRNA-10b promotes migration and invasion through Hoxd10 in human gastric cancer. | |
| 26260613 | 2015 | HOXD10 acts as a tumor-suppressive factor via inhibition of the RHOC/AKT/MAPK pathway in human cholangiocellular carcinoma. | |
| 25301728 | 2014 | POU2F1 activity regulates HOXD10 and HOXD11 promoting a proliferative and invasive phenotype in head and neck cancer. | |
| 25081374 | 2014 | HOXD10 expression in human breast cancer. | |
| 25010866 | 2014 | The roles of HOXD10 in the development and progression of head and neck squamous cell carcinoma (HNSCC). | |
| 24573354 | 2014 | MicroRNA-10b promotes migration and invasion through KLF4 and HOXD10 in human bladder cancer. | |
| 24529757 | 2014 | Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations. | |
| 24376640 | 2013 | MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration. | |
| 24305689 | 2013 | Targeting microRNA-23a to inhibit glioma cell invasion via HOXD10. | |
| 24219032 | 2014 | miR-224 promotion of cell migration and invasion by targeting Homeobox D 10 gene in human hepatocellular carcinoma. | |
| 23670532 | 2013 | Loss of HOXD10 expression induced by upregulation of miR-10b accelerates the migration and invasion activities of ovarian cancer cells. | |
| 22842189 | 2014 | Interaction between Tbx1 and Hoxd10 and connection with TGF?-BMP signal pathway during kidney development. | |
| 22293682 | 2012 | miR-10b promotes cell invasion through RhoC-AKT signaling pathway by targeting HOXD10 in gastric cancer. | |
| 22160393 | 2012 | Homeobox D10 gene, a candidate tumor suppressor, is downregulated through promoter hypermethylation and associated with gastric carcinogenesis. | |
| 21419107 | 2011 | MicroRNA-10b induces glioma cell invasion by modulating MMP-14 and uPAR expression via HOXD10. | |
| 19453261 | 2009 | High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men. | |
| 18922890 | 2008 | MicroRNA-7, a homeobox D10 target, inhibits p21-activated kinase 1 and regulates its functions. | |
| 17417092 | 2007 | Absence of HOXD10 mutations in idiopathic clubfoot and sporadic vertical talus. | |
| 17236141 | 2007 | Mutations in HOXD13 underlie syndactyly type V and a novel brachydactyly-syndactyly syndrome. | |
| 16331564 | 2005 | [Analysis of association between 5' HOXD gene and idiopathic congenital talipes equinovarus]. | |
| 16103068 | 2005 | Homeobox D10 induces phenotypic reversion of breast tumor cells in a three-dimensional culture model. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15368082 | 2004 | Congenital vertical talus in four generations of the same family. | |
| 15146389 | 2004 | A HOX gene mutation in a family with isolated congenital vertical talus and Charcot-Marie-Tooth disease. | |
| 14973489 | 2004 | The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions. | |
| 12954737 | 2004 | HOXC and HOXD gene expression in human endometrium: lack of redundancy with HOXA paralogs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12466126 | 2002 | Sustained expression of homeobox D10 inhibits angiogenesis. | |
| 12357469 | 2002 | Limb malformations and the human HOX genes. | |
| 11857506 | 2002 | Complete mutation analysis panel of the 39 human HOX genes. | |
| 11778160 | 2002 | A 117-kb microdeletion removing HOXD9-HOXD13 and EVX2 causes synpolydactyly. | |
| 11585930 | 2001 | The HOX homeodomain proteins block CBP histone acetyltransferase activity. | |
| 11060466 | 2000 | Clustering of two fragile sites and seven homeobox genes in human chromosome region 2q31-->q32.1. | |
| 10523646 | 1999 | PBX and MEIS as non-DNA-binding partners in trimeric complexes with HOX proteins. | |
| 10364522 | 1999 | Monodactylous limbs and abnormal genitalia are associated with hemizygosity for the human 2q31 region that includes the HOXD cluster. | |
| 9773404 | Expression of HOXD10 gene in normal endometrium and endometrial adenocarcinoma. | ||
| 8100684 | 1993 | Autosomal dominant tetramelic postaxial oligodactyly. | |
| 7967520 | 1994 | Expression of AbdB-type homeobox genes in human tumors. | |
| 7913891 | 1994 | The thyroid transcription factor-1 gene is a candidate target for regulation by Hox proteins. | |
| 2576652 | 1989 | Organization of human class I homeobox genes. | |
| 2574852 | 1989 | The human HOX gene family. | |
| 1981366 | 1990 | Expression of HOX homeogenes in human neuroblastoma cell culture lines. | |
| 1973146 | 1990 | Nomenclature for human homeobox genes. | |
| 1756725 | 1991 | HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities. | |
| 1363084 | 1992 | Why we have (only) five fingers per hand: hox genes and the evolution of paired limbs. | |
| 1358459 | 1992 | Vertebrate homeobox gene nomenclature. | |
| 1351871 | 1992 | Human HOX4E: a gene strongly expressed in the adult male and female urogenital tracts. |
