Tbio | Homeobox protein Hox-D10 |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Arthritis, Rheumatoid | 174 | 0.0 | 0.0 |
Carcinoma, squamous cell of head and neck | 31 | 0.0 | 0.0 |
Charcot-Marie-Tooth disease | 62 | 0.0 | 0.0 |
Flatfoot | 73 | 0.0 | 0.0 |
Lower Extremity Deformities, Congenital | 2 | 0.0 | 0.0 |
Mouth Neoplasms | 55 | 0.0 | 0.0 |
Vertical talus, congenital | 1 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8520 | 7.8e-11 |
lung cancer | 4740 | 6.6e-07 |
non-small cell lung cancer | 2890 | 1.5e-06 |
medulloblastoma, large-cell | 6241 | 1.0e-04 |
adrenocortical carcinoma | 1428 | 2.1e-03 |
adult high grade glioma | 3801 | 3.0e-03 |
glioblastoma | 5792 | 3.9e-03 |
psoriasis | 6694 | 5.7e-03 |
active ulcerative colitis | 764 | 1.0e-02 |
osteosarcoma | 7950 | 1.7e-02 |
Gaucher disease type 3 | 67 | 3.4e-02 |
interstitial cystitis | 2312 | 3.6e-02 |
Disease | log2 FC | p |
---|---|---|
active ulcerative colitis | -1.540 | 1.0e-02 |
adrenocortical carcinoma | 1.904 | 2.1e-03 |
adult high grade glioma | 1.100 | 3.0e-03 |
Gaucher disease type 3 | -2.600 | 3.4e-02 |
glioblastoma | 1.400 | 3.9e-03 |
interstitial cystitis | -1.100 | 3.6e-02 |
lung cancer | 3.900 | 6.6e-07 |
medulloblastoma, large-cell | 1.100 | 1.0e-04 |
non-small cell lung cancer | 1.104 | 1.5e-06 |
osteosarcoma | 2.617 | 1.7e-02 |
ovarian cancer | -2.900 | 7.8e-11 |
psoriasis | -1.100 | 5.7e-03 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG |
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMN 1 - 70 VHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCP 71 - 140 VENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEP 141 - 210 TKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLE 211 - 280 LEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS 281 - 340 //