Property Summary

NCBI Gene PubMed Count 31
PubMed Score 72.02
PubTator Score 522.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -4.200 4.2e-07
osteosarcoma 1.185 1.9e-05
atypical teratoid / rhabdoid tumor 1.400 4.6e-04
glioblastoma 1.100 2.8e-03
medulloblastoma, large-cell 1.400 2.1e-05

Gene RIF (11)

PMID Text
26123838 Upregulated HOXC8 expression was associated with oxaliplatin resistance in hepatocellular carcinoma.
26090721 embigin is regulated by HOXC8 and its loss plays an important role in the progression of breast tumors
25745994 Ectopic expression of HoxC8 inhibits nasopharyngeal carcinoma cell growth in vitro and in vivo, modulates glycolysis and regulates the expression of tricarboxylic acid (TCA) cycle-related genes.
24817935 miR-196a was over-expressed in cervical cancer cells, while an absence of HOXC8 expression was observed.
24810778 HOXC8 promotes breast tumorigenesis by transcriptionally facilitating cadherin-11 expression.
24525058 HOXC8 can be used as a prognostic marker in esophageal squamous cell carcinoma
21712827 HOXC8 expression is inversely related to pancreatic ductal adenocarcinoma progression and metastasis.
21047772 a complex role for HOXC8 in prostate cancer, promoting invasiveness while inhibiting AR-mediated gene induction at androgen response element-regulated genes associated with differentiated function of the prostate
20736365 Ratio of microRNA to HOXC8 mRNA may be an indicator of the metastatic capability of breast tumors.
16637071 Androgen-independent cell line DU145 cells lack PLZF gene expression, resulting in the upregulation of Pbx1 and HoxC8 expression. The Pbx1-HoxC8 heterocomplex may lead to androgen-independent growth in prostate cancer.
11813208 overexpression associated with loss of tumor differentiation in human prostate cancer; may play role in acquisition of invasive/metastatic phenotype

AA Sequence

MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNS      1 - 70
GYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFP     71 - 140
WMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNK    141 - 210
DKLPGARDEEKVEEEGNEEEEKEEEEKEENKD                                          211 - 242
//

Text Mined References (32)

PMID Year Title
26123838 2015 Upregulated HOXC8 Expression Is Associated with Poor Prognosis and Oxaliplatin Resistance in Hepatocellular Carcinoma.
26090721 2015 Embigin, regulated by HOXC8, plays a suppressive role in breast tumorigenesis.
25745994 2015 Repression of Hox genes by LMP1 in nasopharyngeal carcinoma and modulation of glycolytic pathway genes by HoxC8.
24817935 2014 Heterogeneity of microRNAs expression in cervical cancer cells: over-expression of miR-196a.
24810778 2014 HOXC8 promotes breast tumorigenesis by transcriptionally facilitating cadherin-11 expression.
24525058 2014 The survival predictive significance of HOXC6 and HOXC8 in esophageal squamous cell carcinoma.
21712827 2011 Expression of HOXC8 is inversely related to the progression and metastasis of pancreatic ductal adenocarcinoma.
21047772 2010 HOXC8 inhibits androgen receptor signaling in human prostate cancer cells by inhibiting SRC-3 recruitment to direct androgen target genes.
20736365 2010 Ratio of miR-196s to HOXC8 messenger RNA correlates with breast cancer cell migration and metastasis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16637071 2006 PLZF regulates Pbx1 transcription and Pbx1-HoxC8 complex leads to androgen-independent prostate cancer proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14973489 2004 The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12925734 2003 Homez, a homeobox leucine zipper gene specific to the vertebrate lineage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11551904 2001 Functional interaction of Jun and homeodomain proteins.
11139569 2001 Transcriptional mechanisms of bone morphogenetic protein-induced osteoprotegrin gene expression.
10722652 2000 Smad6 as a transcriptional corepressor.
10617598 2000 The leukemia-associated protein Btg1 and the p53-regulated protein Btg2 interact with the homeoprotein Hoxb9 and enhance its transcriptional activation.
10224145 1999 Smad1 interacts with homeobox DNA-binding proteins in bone morphogenetic protein signaling.
9357979 1997 Distinct patterns of all-trans retinoic acid dependent expression of HOXB and HOXC homeogenes in human embryonal and small-cell lung carcinoma cell lines.
8646877 1996 Fine mapping of human HOX gene clusters.
8104467 1993 Expression of HOX C homeobox genes in lymphoid cells.
2886047 1987 Human homeo box-containing genes located at chromosome regions 2q31----2q37 and 12q12----12q13.
2885844 1987 Two human homeobox genes, c1 and c8: structure analysis and expression in embryonic development.
2878432 1986 Cognate homeo-box loci mapped on homologous human and mouse chromosomes.
2576652 1989 Organization of human class I homeobox genes.
2574852 1989 The human HOX gene family.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.