Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.86
PubTator Score 9.10

Knowledge Summary

Patent

No data available

Expression

 MGI Phenotype (1)

Gene RIF (2)

AA Sequence

MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAH      1 - 70
PDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQI     71 - 140
YPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKW    141 - 210
KKDSKMKSKEAL                                                              211 - 222
//

Text Mined References (17)

PMID Year Title