Property Summary

NCBI Gene PubMed Count 31
PubMed Score 37.56
PubTator Score 567.84

Knowledge Summary

Patent

No data available

Gene RIF (12)

PMID Text
25691658 YAP regulates the expression of HOXA1 and HOXC13 in human keratinocytes.
24085196 In conclusion, our data show a deregulation of the HOXC13 marker in welldifferentiated and dedifferentiated LPSs, possibly related to 12q13-15 chromosomal amplification.
23461661 Results show that duplication and nonsense mutation lead to loss of function in this gene and the role it plays in hair and nail development
23315978 Identification of a homozygous mutation in the HOXC13 gene in a Syrian family with autosomal-recessive pure hair and nail ectodermal dysplasia.
23063621 loss-of-function mutations in HOXC13 cause autosomal-recessive PHNED and further highlight the importance of HOXC13 in hair and nail development.
22583695 results show the strong and progressive HOX C13 overexpression in metastatic melanoma tissues and cytological samples compared to nevi and primary melanoma tissues and cells.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20661663 knockdown of BMI-1 expression can induce cell-cycle arrest and up-regulate p16INK4a, HOXA9 and HOXC13 in HeLa cells
19665070 To our knowledge, this is the first case of t(11;12)(p15;q13) in de novo AML-M4 in association with FLT3 ITD mutation. Coexistence of NUP98-HOXC13 fusion and FLT3 ITD mutation is likely relevant in the process of leukemogenesis
19182517 Results show that HOXC13 is a member of human replicative complexes.
17331444 HOXC13 was highly expressed in ameloblastoma. Heterogeneous expression could improve the epithelial proliferation, and its loss may lead to the cornification and degeneration of epithelial cells.
15385554 Krtap16 is a hair keratin-associated protein gene complex regulated by Hoxc13

AA Sequence

MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCR      1 - 70
DLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNL     71 - 140
QQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIP    141 - 210
VEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYA    211 - 280
ASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLHST                        281 - 330
//

Text Mined References (31)

PMID Year Title
25691658 2015 YAP regulates the expression of Hoxa1 and Hoxc13 in mouse and human oral and skin epithelial tissues.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25343990 2015 Genome-wide association study of selenium concentrations.
24085196 2013 Hyperexpression of HOXC13, located in the 12q13 chromosomal region, in well?differentiated and dedifferentiated human liposarcomas.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23461661 2013 Novel mutations in the gene HOXC13 underlying pure hair and nail ectodermal dysplasia in consanguineous families.
23315978 2013 A homozygous frameshift mutation in the HOXC13 gene underlies pure hair and nail ectodermal dysplasia in a Syrian family.
23063621 2012 Loss-of-function mutations in HOXC13 cause pure hair and nail ectodermal dysplasia.
22583695 2012 Increased HOX C13 expression in metastatic melanoma progression.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20661663 2011 Knockdown of BMI-1 causes cell-cycle arrest and derepresses p16INK4a, HOXA9 and HOXC13 mRNA expression in HeLa cells.
20460270 2010 Genome-wide association study identifies a susceptibility locus for biliary atresia on 10q24.2.
19665070 2009 Acute myeloid leukemia with NUP98-HOXC13 fusion and FLT3 internal tandem duplication mutation: case report and literature review.
19182517 2009 The homeotic protein HOXC13 is a member of human DNA replication complexes.
18692240 2009 Physical and functional interactions between hematopoietic cell-specific ETS transcription factors and homeodomain proteins.
17331444 2007 [Expression of HOXC13 in ameloblastoma].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385554 2004 Krtap16, characterization of a new hair keratin-associated protein (KAP) gene complex on mouse chromosome 16 and evidence for regulation by Hoxc13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461755 2003 Fusion of the NUP98 gene and the homeobox gene HOXC13 in acute myeloid leukemia with t(11;12)(p15;q13).
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11118201 2000 Inhibition of Bmp signaling affects growth and differentiation in the anagen hair follicle.
10835276 2000 Selection of homeotic proteins for binding to a human DNA replication origin.
10674376 1999 Hair defects in Hoxc13 mutant mice.
9357979 1997 Distinct patterns of all-trans retinoic acid dependent expression of HOXB and HOXC homeogenes in human embryonal and small-cell lung carcinoma cell lines.
8646877 1996 Fine mapping of human HOX gene clusters.
2878432 1986 Cognate homeo-box loci mapped on homologous human and mouse chromosomes.
2574852 1989 The human HOX gene family.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.