Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.76
PubTator Score 10.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.8e-06
medulloblastoma, large-cell 6234 1.4e-05
malignant mesothelioma 3163 2.2e-04
psoriasis 6685 3.5e-04
cutaneous lupus erythematosus 1056 7.0e-03
Disease Target Count Z-score Confidence
Clubfoot 35 3.966 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 2.2e-04
cutaneous lupus erythematosus -1.800 7.0e-03
psoriasis -1.200 3.5e-04
osteosarcoma 2.428 1.8e-06
medulloblastoma, large-cell 1.200 1.4e-05

Gene RIF (3)

PMID Text
25476856 Our data suggest that HOXC11 may contribute to RCC carcinogenesis by increasing tumor cell proliferation and imply that HOXC11 may be an important determinant of RCC patient prognosis
20145129 HOXC11 and SRC-1 cooperate to regulate expression of the calcium-binding protein S100beta in resistant breast cancer cells.
17488478 HOXC11 increases transcription of S100beta gene in BrdU-induced in vitro differentiation of GOTO neuroblastoma cells into Schwann cells.

AA Sequence

MFNSVNLGNFCSPSRKERGADFGERGSCASNLYLPSCTYYMPEFSTVSSFLPQAPSRQISYPYSAQVPPV      1 - 70
REVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHATPAGFYSS     71 - 140
VNKNSVLPQAFDRFFDNAYCGGGDPPAEPPCSGKGEAKGEPEAPPASGLASRAEAGAEAEAEEENTNPSS    141 - 210
SGSAHSVAKEPAKGAAPNAPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWF    211 - 280
QNRRMKEKKLSRDRLQYFSGNPLL                                                  281 - 304
//

Text Mined References (18)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25476856 2015 Overexpression of HOXC11 homeobox gene in clear cell renal cell carcinoma induces cellular proliferation and is associated with poor prognosis.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
20145129 2010 Interaction of developmental transcription factor HOXC11 with steroid receptor coactivator SRC-1 mediates resistance to endocrine therapy in breast cancer [corrected].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17488478 HOXC6 and HOXC11 increase transcription of S100beta gene in BrdU-induced in vitro differentiation of GOTO neuroblastoma cells into Schwannian cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
9582375 1998 The HOXC11 homeodomain protein interacts with the lactase-phlorizin hydrolase promoter and stimulates HNF1alpha-dependent transcription.
9357979 1997 Distinct patterns of all-trans retinoic acid dependent expression of HOXB and HOXC homeogenes in human embryonal and small-cell lung carcinoma cell lines.
8646877 1996 Fine mapping of human HOX gene clusters.
2878432 1986 Cognate homeo-box loci mapped on homologous human and mouse chromosomes.
2574852 1989 The human HOX gene family.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.