Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.82
PubTator Score 738.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus -3.000 1.8e-03
psoriasis -2.200 5.8e-05
osteosarcoma 1.420 5.6e-03
glioblastoma 1.600 5.9e-03
atypical teratoid / rhabdoid tumor 1.500 1.2e-02
medulloblastoma, large-cell 2.500 1.3e-03
fascioscapulohumeral muscular dystrophy -2.630 1.3e-12
non-small cell lung cancer 1.581 1.5e-08
intraductal papillary-mucinous neoplasm ... 2.300 7.1e-04
adult high grade glioma 1.600 1.3e-05
breast carcinoma 1.500 9.3e-16
Breast cancer 1.500 1.6e-03
ductal carcinoma in situ 2.500 9.7e-05
invasive ductal carcinoma 3.000 1.8e-04

Gene RIF (6)

PMID Text
26647900 HOXC9 and HOXC10 may play an important role in the development of obesity, adverse fat distribution, and subsequent alterations in whole-body metabolism and adipose tissue function.
26279264 This study investigates the role and clinical implication of HOXC10 in human thyroid cancer.
24670685 Reduced HOXC10 in vitro and in xenografts resulted in decreased apoptosis and caused antiestrogen resistance.
19522674 Data demonstrate that HOXC10 is a gene that may discriminate between amnion-derived mesenchymal stem cells (MSCs) and decidua-derived MSCs.
17974957 Cervical cancer cells with high endogenous levels of HOXC10 were less invasive after short hairpin RNA-mediated knockdown of HOXC10 expression; findings support a key role for the HOXC10 homeobox protein in cervical cancer progression
12853486 Early mitotic dedgradation of the homeoprotein HOXC10 is potentially linked to cell cycle progression.

AA Sequence

MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYP      1 - 70
SYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGE     71 - 140
HEVPVPSYYRASPSYSALDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPS    141 - 210
PNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQT    211 - 280
LELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT            281 - 342
//

Text Mined References (22)

PMID Year Title
26647900 2016 Fat depot-specific expression of HOXC9 and HOXC10 may contribute to adverse fat distribution and related metabolic traits.
26279264 2015 HOXC10 up-regulation contributes to human thyroid cancer and indicates poor survival outcome.
26018586 2015 Anterior migration of lateral plate mesodermal cells during embryogenesis of the pufferfish Takifugu niphobles: insight into the rostral positioning of pelvic fins.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24670685 2014 Epigenetic reprogramming of HOXC10 in endocrine-resistant breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19522674 2009 HOXC10 as a potential marker for discriminating between amnion- and decidua-derived mesenchymal stem cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974957 2007 Gene expression analysis of preinvasive and invasive cervical squamous cell carcinomas identifies HOXC10 as a key mediator of invasion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853486 2003 Early mitotic degradation of the homeoprotein HOXC10 is potentially linked to cell cycle progression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11445587 2001 A yeast four-hybrid system identifies Cdk-activating kinase as a regulator of the XPD helicase, a subunit of transcription factor IIH.
10835276 2000 Selection of homeotic proteins for binding to a human DNA replication origin.
9357979 1997 Distinct patterns of all-trans retinoic acid dependent expression of HOXB and HOXC homeogenes in human embryonal and small-cell lung carcinoma cell lines.
8646877 1996 Fine mapping of human HOX gene clusters.
2878432 1986 Cognate homeo-box loci mapped on homologous human and mouse chromosomes.
2574852 1989 The human HOX gene family.
1358459 1992 Vertebrate homeobox gene nomenclature.