Property Summary

NCBI Gene PubMed Count 46
PubMed Score 29.53
PubTator Score 40.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.1e-03
colon cancer 1475 2.2e-03
osteosarcoma 7933 9.3e-03
aldosterone-producing adenoma 664 1.8e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.004 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.005 9.3e-03
medulloblastoma, large-cell 1.100 1.1e-03
colon cancer 1.500 2.2e-03
aldosterone-producing adenoma 1.043 1.8e-02

Gene RIF (21)

PMID Text
26544896 Expression of GalNAc-T14 or HOXB9 was strongly correlated with reduced recurrence-free survival in lung adenocarcinomas.
26536658 the results of the present study suggested that HOXB9 is a tumor suppressor in gastric carcinoma, and its activity was controlled by different regulatory mechanisms such as the hexapeptide motif as a "brake" in this case
25860510 Knock-down of HOXB9 expression decreased migration, invasion and proliferation but did not alter adhesion.
25724625 Low HOXB9 expression promotes pancreatic ductal adenocarcinoma progression.
25136922 Identification of the transcription factor binding site of the HOXB9 promoter region suggests that E2F1 is a direct regulator of HOXB9 expression in breast cancer.
25081022 HOXB9 promotes epithelial-to-mesenchymal transition via TGF-beta1 pathway in hepatocellular carcinoma cells.
25025961 HOXB9 promoted colon adenocarcinoma differentiation.
24600698 rs2303486 may be associated with severity of developmental dysplaasia of the hip in Chinese Han females.
24582746 HOXB9 overexpression increased the tumorigenicity of glioma cells in vivo. Moreover, the activation of transforming growth factor-beta1 contributed to HOXB9-induced oncogenic activities.
24462859 Data show that the HOXB9 overexpression group had significantly shorter overall survival time than the HOXB9 downexpression group.
23350386 The expression of HOXB9, its relationship to clinical factors in breast cancer and efficacy as a prognostic factor were discussed.
23332081 HOXB9 is down-regulation in gastric carcinoma and may be a novel prognostic marker for poorer clinical outcome for patients with gastric carcinoma.
22863320 HOXB9 is overexpressed in breast cancer tissue.
22396001 HOXB9 overexpression promoting tumor cell proliferation and angiogenesis is associated with breast cancer.
22225776 reduced expression of CD56 is associated with homeobox B9 in papillary thyroid carcinomas. Further, silencing of homeobox B9 is more common in older age and is linked to extrathyroidal extension and advanced pathologic stage of papillary thyroid carcinoma
21930940 The effect of HOXB9 on the response to ionizing radiation requires the baseline ATM activity before irradiation and epithelial-to-mesenchymal transition induced by TGF-beta.
21428455 HOXB9 is an E2-responsive gene and ERs coordinate with MLL1 and MLL3 in E2-mediated transcriptional regulation of HOXB9.
20080567 deregulated expression of HOXB9 contributes to breast cancer progression and lung metastasis by inducing several growth factors that alter tumor-specific cell fates and the tumor stromal microenvironment
19576624 Two WNT target genes, LEF1 and HOXB9, are identified as promoters of lung adenocarcinoma metastasis and mediators of chemotactic invasion and colony outgrowth.
19341834 Observational study of gene-disease association. (HuGE Navigator)
17148583 ERK5 probably mediates HOXB9 expression by repressing BMI1 in Hodgkin lymphoma cell lines

AA Sequence

MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHA      1 - 70
SGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLET     71 - 140
SAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYL    141 - 210
TRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE                                  211 - 250
//

Text Mined References (47)

PMID Year Title
26544896 2015 GalNAc-T14 promotes metastasis through Wnt dependent HOXB9 expression in lung adenocarcinoma.
26536658 2015 HOXB9 induction of mesenchymal-to-epithelial transition in gastric carcinoma is negatively regulated by its hexapeptide motif.
25860510 2015 The role of HOXB9 and miR-196a in head and neck squamous cell carcinoma.
25724625 2015 Kindlin-2 induced by TGF-? signaling promotes pancreatic ductal adenocarcinoma progression through downregulation of transcriptional factor HOXB9.
25416956 2014 A proteome-scale map of the human interactome network.
25136922 2014 An E2F1-HOXB9 transcriptional circuit is associated with breast cancer progression.
25081022 2015 HOXB9 promotes epithelial-to-mesenchymal transition via transforming growth factor-?1 pathway in hepatocellular carcinoma cells.
25025961 2014 Elevated HOXB9 expression promotes differentiation and predicts a favourable outcome in colon adenocarcinoma patients.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24600698 2014 Association of a single nucleotide polymorphism in HOXB9 with developmental dysplasia of the hip: a case-control study.
24582746 2014 Overexpressed homeobox B9 regulates oncogenic activities by transforming growth factor-?1 in gliomas.
24462859 2014 Homeobox B9 is overexpressed in hepatocellular carcinomas and promotes tumor cell proliferation both in vitro and in vivo.
23350386 2012 [HOXB9 as a novel prognostic factor in breast cancer].
23332081 2013 Decreased expression of HOXB9 is related to poor overall survival in patients with gastric carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22863320 2012 Homeodomain-containing protein HOXB9 regulates expression of growth and angiogenic factors, facilitates tumor growth in vitro and is overexpressed in breast cancer tissue.
22396001 2012 HOXB9 expression promoting tumor cell proliferation and angiogenesis is associated with clinical outcomes in breast cancer patients.
22225776 2012 Silencing of homeobox B9 is associated with down-regulation of CD56 and extrathyroidal extension of tumor in papillary thyroid carcinoma.
21930940 2012 Homeobox B9 induces epithelial-to-mesenchymal transition-associated radioresistance by accelerating DNA damage responses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21428455 2011 Histone methylases MLL1 and MLL3 coordinate with estrogen receptors in estrogen-mediated HOXB9 expression.
20080567 2010 HOXB9, a gene overexpressed in breast cancer, promotes tumorigenicity and lung metastasis.
19576624 2009 WNT/TCF signaling through LEF1 and HOXB9 mediates lung adenocarcinoma metastasis.
19341834 2009 Do HOXB9 and COL1A1 genes play a role in congenital dislocation of the hip? Study in a Caucasian population.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17148583 2007 Comprehensive analysis of homeobox genes in Hodgkin lymphoma cell lines identifies dysregulated expression of HOXB9 mediated via ERK5 signaling and BMI1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15839736 2005 Differentiation of insulin-producing cells from human neural progenitor cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11585930 2001 The HOX homeodomain proteins block CBP histone acetyltransferase activity.
11485933 2001 Clinical and experimental progression of a new model of human prostate cancer and therapeutic approach.
11070089 2000 Altered HOX and WNT7A expression in human lung cancer.
10617598 2000 The leukemia-associated protein Btg1 and the p53-regulated protein Btg2 interact with the homeoprotein Hoxb9 and enhance its transcriptional activation.
9922051 1998 Modulation of homeobox B6 and B9 genes expression in human leukemia cell lines during myelomonocytic differentiation.
8646877 1996 Fine mapping of human HOX gene clusters.
2576652 1989 Organization of human class I homeobox genes.
2574852 1989 The human HOX gene family.
2570724 1989 Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.
1981366 1990 Expression of HOX homeogenes in human neuroblastoma cell culture lines.
1973146 1990 Nomenclature for human homeobox genes.
1712647 1991 Selective expression of two homeobox genes in CD34-positive cells from human bone marrow.
1358459 1992 Vertebrate homeobox gene nomenclature.