Property Summary

NCBI Gene PubMed Count 37
PubMed Score 63.68
PubTator Score 45.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 1.3e-04
cutaneous lupus erythematosus 1056 1.3e-03
osteosarcoma 7933 2.2e-03
medulloblastoma, large-cell 6234 9.4e-03
colon cancer 1475 4.6e-02
Disease Target Count Z-score Confidence
Obesity 616 0.0 2.0
Disease Target Count Z-score Confidence
Gastroschisis 9 3.561 1.8
Hirschsprung's disease 44 3.513 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -1.600 1.3e-03
psoriasis -1.600 1.3e-04
osteosarcoma 1.675 2.2e-03
medulloblastoma, large-cell 1.600 9.4e-03
colon cancer 1.400 4.6e-02

Gene RIF (14)

PMID Text
26467157 HOXB5 may be an important regulator of the Wnt/beta-catenin signalling pathway, thereby contributing to gastric cancer progression and metastasis.
25999793 HOXB5 acts as a positive modulator by promoting cell proliferative response and invasiveness in ER-positive breast cancer.
25703667 Roles of Hoxb5 in the development of vagal and trunk neural crest cells.
24189625 Overexpression of HoxB5 enhances blood vessel perfusion in vivo by up-regulation of MCP-1 and IL-6 as well as in enhanced leucocyte infiltration and blood vessel remodelling.
23438671 HOXB5 and HOXB8 are frequently expressed in ovarian serous carcinoma, with anatomic site-related differences for cytoplasmic staining. HOXB5 may be affected by chemotherapy in effusions.
22768238 A miRNA 7-binding single nucleotide polymorphism (1010A/G) located within 3'-UTR of HOXB5 is associated with gene expression and may be a promising prognostic factor for bladder cancer.
22648184 The findings for HOXB5 and PHOX2B provide supportive evidence that genes regulating ENCC proliferation, migration and differentiation could be risk factors for Hirschsprung's disease
22603795 HOXB5, HOXB6, and HOXB7 are activated in Barrett esophagus, and the midcluster HOXB gene signature in BE most resembled the colon rather than other GI epithelia.
22484627 Single nucleotide polymorphism in HOXB5 gene is associated with childhood obesity.
21677782 Data show that human HOXB5 binds to the promoter region 5' upstream of the binding site of NKX2-1 and regulates RET expression.
21552713 results support that expression of HOX genes is associated with oral squamous cell carcinoma; over 90% of OSCC samples presented HOXB5 expression versus 60% of non-tumor tissues, it can be suggested that HOXB5 may be related to the malignant phenotypes.
17623056 DNA hypermethylation of tumour suppressor genes seems to play an important role in ovarian carcinogenesis and HOXA9, HOXB5, SCGB3A1, and CRABP1 are identified as novel hypermethylated target genes in this tumour type
12950074 The expression pattern of HOXB5 correlated with the migration and differentiation of neural crest cells.
12897140 HoxB5 is necessary and sufficient to activate the cell-intrinsic events that regulate the differentiation of angioblasts and mature endothelial cells from their mesoderm-derived precursors

AA Sequence

MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG      1 - 70
ESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASS     71 - 140
EPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELE    141 - 210
KEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP               211 - 269
//

Text Mined References (38)

PMID Year Title
26467157 2015 HOXB5 induces invasion and migration through direct transcriptional up-regulation of ?-catenin in human gastric carcinoma.
25999793 2015 HOXB5 Promotes the Proliferation and Invasion of Breast Cancer Cells.
25703667 2015 Roles of Hoxb5 in the development of vagal and trunk neural crest cells.
25416956 2014 A proteome-scale map of the human interactome network.
24189625 2014 The transcription factor HoxB5 stimulates vascular remodelling in a cytokine-dependent manner.
23438671 2013 HOXB8 expression in ovarian serous carcinoma effusions is associated with shorter survival.
22768238 2012 A microRNA-7 binding site polymorphism in HOXB5 leads to differential gene expression in bladder cancer.
22648184 2012 Hirschsprung's disease and variants in genes that regulate enteric neural crest cell proliferation, migration and differentiation.
22603795 2012 Evidence for a functional role of epigenetically regulated midcluster HOXB genes in the development of Barrett esophagus.
22484627 2012 A genome-wide association meta-analysis identifies new childhood obesity loci.
21677782 2011 HOXB5 cooperates with NKX2-1 in the transcription of human RET.
21552713 2011 HOXB5 expression in oral squamous cell carcinoma.
17623056 2007 DNA methylation profiling of ovarian carcinomas and their in vitro models identifies HOXA9, HOXB5, SCGB3A1, and CRABP1 as novel targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14632303 2003 Expression of Hoxb-5 during human lung development and in congenital lung malformations.
12950074 2003 HOXB5 expression is spatially and temporarily regulated in human embryonic gut during neural crest cell colonization and differentiation of enteric neuroblasts.
12897140 2003 HoxB5 is an upstream transcriptional switch for differentiation of the vascular endothelium from precursor cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11839528 2002 Thyroid hormone affects embryonic mouse lung branching morphogenesis and cellular differentiation.
8930688 1996 Localization of the HoxB5 protein in the developing CNS of late gestational mouse embryos.
8688592 1996 Expression of homebox-containing genes in human preimplantation development and in embryos with chromosomal aneuploidies.
8646877 1996 Fine mapping of human HOX gene clusters.
8101633 1993 Cooperative DNA binding of the human HoxB5 (Hox-2.1) protein is under redox regulation in vitro.
6091895 1984 Human DNA sequences homologous to a protein coding region conserved between homeotic genes of Drosophila.
4075393 1985 Expression of homologous homeo-box-containing genes in differentiated human teratocarcinoma cells and mouse embryos.
3453105 1986 A human homoeo box gene specifically expressed in spinal cord during embryonic development.
3186746 1988 Construction of a genetic map of human chromosome 17 by use of chromosome-mediated gene transfer.
3000607 1985 Homeo box gene complex on mouse chromosome 11: molecular cloning, expression in embryogenesis, and homology to a human homeo box locus.
2878432 1986 Cognate homeo-box loci mapped on homologous human and mouse chromosomes.
2576652 1989 Organization of human class I homeobox genes.
2574852 1989 The human HOX gene family.
2570724 1989 Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.
1981366 1990 Expression of HOX homeogenes in human neuroblastoma cell culture lines.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.
1355360 1992 Cooperative DNA binding of the highly conserved human Hox 2.1 homeodomain gene product.