Property Summary

NCBI Gene PubMed Count 51
PubMed Score 156.10
PubTator Score 97.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (32)

PMID Text
26867567 The analysis of HOX expression in primary mesothelioma tumors indicated that these cells could also be sensitive to the disruption of HOX activity by HXR9, and that the expression of HOXB4 is strongly associated with overall survival
26202933 showed that OAC1 treatment led to OCT4-mediated upregulation of HOXB4
26166023 HOXA4 increases short-term repopulation to higher levels than HOXB4, which may involve Notch signaling to induce self-renewal of primitive hematopoietic cells
25996682 decreased methylation at HOXB3 and HOXB4 was associated with increased gene expression of both HOXB genes specific to the mid-risk AML, while increased DNA methylation at DCC distinctive to the high-risk AML was associated with increased gene expression
24859765 Epigenetic analysis revealed that increased promoter methylation of HOXB4 correlates with decreased expression of its transcript in oral cancer cell lines. HOXB4 may work as an epigenetic biomarker gene.
24810639 a crucial regulator of NK lytic function
23630040 Our study demonstrates for the first time the regulation of HOXB4 by miR-23a
23028422 GATA-2 directly regulates HOXB4 expression in hematopoietic stem cells, which may play an important role in the development and/or progression of aplastic anemia.
22761810 our results outline the effects of HOXB4 in combination with stromal cells in the development of NK cells from embryonic stem cells.
22664110 HOXB4-positivity as an independent predictor of overall survival of acute myeloid leukemia patients
22438249 Down-regulation of mitochondria and lysosomal genes by HoxB4 plays a role in the impaired lymphoid lineage development from embryonic stem cells-derived hematopoietic stem cells.
22402911 cytomegalovirus infection markedly down-regulated HOXB4 expression which affected proliferation and differentiation of erythroid and lymphocyte progenitor cells.
22298821 Comparative transcriptome analysis of CD34(+) cells subjected or not to HOXB4 or HOXC4 demonstrated that both homeoproteins regulate the same set of genes, some of which encode key hematopoietic factors and signaling molecules.
22120585 Hox B4 protein is present in the precursor lesions as CC cells, suggesting that Hox B4 could be a protein related to the neoplastic state (non-differentiated cells) of human cervical epithelium.
22040961 Expressions of ABCB1, BMI-1, HOXB4 were not detected in the patients with non-malignant hematologic diseases, but were higher in de novo acute leukemia patients and lower in patients in complete remission.
22000550 These results indicate that transient, but not constitutive, HoxB4 expression is sufficient to augment the hematopoietic differentiation of embryonic stem and induced pluripotent stem cells.
21546695 Studies suggest that HOXA4, HOXA5 and HOXB4 provide the spatial information needed to restrict the response to signals from the notochord, and not up regulated in pancreatic cancer.
20625746 Downregulation of HoxB2, HoxB4 and Alx4 expression during the narrow window of early embryogenesis may cause omphalocele in the Cd chick model by interfering with molecular signaling required for proper VBW formation.
20599537 these data suggest that increased HoxB4 enhanced early megakaryocytic development in human TF1 cells and CD34 positively-selected cord blood cells primarily by upregulating TpoR and Fli-1 expression and downregulating c-Myb expression.
20030938 hoxb2 and hoxb4 expression is related to erythroid hematopoiesis, and hoxb4 has greater relevance to erythroid hematopoiesis as compared with hoxb2.
19878058 overexpression of HOXB4 in human ESC did not improve the generation of CD34(+) hematopoietic cells via co-culture methodology
19549386 The demethylation of CpG island in the promoter region of HOXB4 gene may be correlated with the high expression of HOXB4 gene in CD34(+) cells, while the promoter methylation of HOXB4 gene may be associated with HOXB4 gene silencing in PBMCs.
18617691 These data suggest that HoxB4-induced effects on human embryonic stem cell-derived hematopoietic stem cells are concentration-dependent during in vitro development and reduce proliferation of other cell types in vitro and in vivo.
18511880 overexpression of HoxB4 in differentiating hESCs increases hematopoietic colony formation and hematopoietic cell formation in vitro, but does not affect in vivo repopulation in adult mice hosts
17962697 contribution of HOXB4 in the maintenance of the intrinsic lymphomyeloid differentiation potential of defined hematopoietic progenitor cell subsets
17784829 The protein transduction domain-Hoxb4protein can be used with other recombinant proteins to efficiently generate transplantable hemaat4opoietic stem cells from human embryonic stem cells.
17510218 The growth promoting effects of HOXB4 are critically dependent on HOXB4 expression levels and that this can result in important species-specific differences in potency.
14966272 Data report novel nucleoporin 98 fusions with homeobox (HOX)A10, HOXB3 and HOXB4, and describe the results of coexpression of these proteins with the Hox cofactor Meis1 in leukemic induction.
12791656 NF-Y is a developmentally regulated inducer of the HOXB4 gene in hematopoietic cells.
12406897 In NOD/SCID mice HOXB4-overexpressing cord blood CD34+ cells had a selective growth advantage in vivo. However, high HOXB4 expression substantially impaired myeloerythroid differentiation & B-cell output.
12130496 Retrovirally mediated expression of HOXB4 rapidly triggers an increase in the number of stem cells without alternating the balance of lymphomyeloid reconstitution, suggesting that HOXB4 does not affect control of end-cell output.
11984874 may play a role in the regulation of cellular proliferation/adhesion in developing fetal human epidermis and in hyperproliferation conditions, including cancers, in adult epidermis

AA Sequence

MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRD      1 - 70
PGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPPCAQNPLHPSPSHSACKEPV     71 - 140
VYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWF    141 - 210
QNRRMKWKKDHKLPNTKIRSGGAAGSAGGPPGRPNGGPRAL                                 211 - 251
//

Text Mined References (53)

PMID Year Title
26867567 2016 HOX transcription factors are potential targets and markers in malignant mesothelioma.
26202933 2016 Activation of OCT4 enhances ex vivo expansion of human cord blood hematopoietic stem and progenitor cells by regulating HOXB4 expression.
26166023 2015 HOXA4 provides stronger engraftment potential to short-term repopulating cells than HOXB4.
25996682 2015 Identification of differentially methylated markers among cytogenetic risk groups of acute myeloid leukemia.
24859765 2014 Epigenetic repression of HOXB cluster in oral cancer cell lines.
24810639 2014 Enhanced cytotoxic activity of ex vivo-differentiated human natural killer cells in the presence of HOXB4.
23630040 2013 Identification of the transcription factor HOXB4 as a novel target of miR-23a.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028422 2012 Gene expression profiling identifies HOXB4 as a direct downstream target of GATA-2 in human CD34+ hematopoietic cells.
22761810 2012 The HOXB4 homeoprotein promotes the ex vivo enrichment of functional human embryonic stem cell-derived NK cells.
22664110 2012 Prognostic significance of HOXB4 in de novo acute myeloid leukemia.
22438249 2012 Dynamic HoxB4-regulatory network during embryonic stem cell differentiation to hematopoietic cells.
22402911 2012 Studies on HOXB4 expression during differentiation of human cytomegalovirus-infected hematopoietic stem cells into lymphocyte and erythrocyte progenitor cells.
22298821 2012 HOXC4 homeoprotein efficiently expands human hematopoietic stem cells and triggers similar molecular alterations as HOXB4.
22120585 2012 Hox B4 as potential marker of non-differentiated cells in human cervical cancer cells.
22040961 2011 [Clinical significance of leukemia stem/progenitor cell related gene expression in acute leukemia].
22000550 2012 Promotion of hematopoietic differentiation from mouse induced pluripotent stem cells by transient HoxB4 transduction.
21546695 2011 HOX genes in pancreatic development and cancer.
20625746 2010 HoxB2, HoxB4 and Alx4 genes are downregulated in the cadmium-induced omphalocele in the chick model.
20599537 2010 Effect of increased HoxB4 on human megakaryocytic development.
20030938 2009 [Effect of ATRA on the expression of genes Hoxb2 and Hoxb4 in cord blood erythroid progenitors].
19878058 2009 Generation of mesenchymal stromal cells from HOXB4-expressing human embryonic stem cells.
19549386 2009 [Analysis on promoter CpG methylation and expression of HOXB4 gene in cord blood CD34(+) cells and peripheral blood mononuclear cells].
18932205 2009 Differentiation of human embryonic stem cells into osteogenic or hematopoietic lineages: a dose-dependent effect of osterix over-expression.
18617691 2008 Lentiviral-mediated HoxB4 expression in human embryonic stem cells initiates early hematopoiesis in a dose-dependent manner but does not promote myeloid differentiation.
18511880 2008 Forced expression of HoxB4 enhances hematopoietic differentiation by human embryonic stem cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17962697 2008 The HOXB4 homeoprotein differentially promotes ex vivo expansion of early human lymphoid progenitors.
17784829 2007 Recombinant HoxB4 fusion proteins enhance hematopoietic differentiation of human embryonic stem cells.
17510218 2007 Effects of HOXB4 overexpression on ex vivo expansion and immortalization of hematopoietic cells from different species.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966272 2004 Differential and common leukemogenic potentials of multiple NUP98-Hox fusion proteins alone or with Meis1.
14578882 2003 Ex vivo expansion of human hematopoietic stem cells by direct delivery of the HOXB4 homeoprotein.
12791656 2003 NF-Y cooperates with USF1/2 to induce the hematopoietic expression of HOXB4.
12761847 2003 HOXB13 homeodomain protein is cytoplasmic throughout fetal skin development.
12701098 2003 TALE class homeodomain gene Irx5 is an immediate downstream target for Hoxb4 transcriptional regulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406897 2003 High-level ectopic HOXB4 expression confers a profound in vivo competitive growth advantage on human cord blood CD34+ cells, but impairs lymphomyeloid differentiation.
12130496 2002 Deregulated expression of HOXB4 enhances the primitive growth activity of human hematopoietic cells.
11984874 2002 HOXB4 homeodomain protein is expressed in developing epidermis and skin disorders and modulates keratinocyte proliferation.
11585930 2001 The HOX homeodomain proteins block CBP histone acetyltransferase activity.
11250656 2001 Antisense knockout of HOXB4 blocks 1,25-dihydroxyvitamin D3 inhibition of c-myc expression.
11085749 2000 Hematopoietic expression of HOXB4 is regulated in normal and leukemic stem cells through transcriptional activation of the HOXB4 promoter by upstream stimulating factor (USF)-1 and USF-2.
10904875 Immunocytochemical detection of the homeobox B3, B4, and C6 gene products within the human thymic cellular microenvironment.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8688592 1996 Expression of homebox-containing genes in human preimplantation development and in embryos with chromosomal aneuploidies.
2576652 1989 Organization of human class I homeobox genes.
2574852 1989 The human HOX gene family.
2570724 1989 Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.
1981366 1990 Expression of HOX homeogenes in human neuroblastoma cell culture lines.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.
1351762 1992 Expression of selected human HOX-2 genes in B/T acute lymphoid leukemia and interleukin-2/interleukin-1 beta-stimulated natural killer lymphocytes.