Property Summary

NCBI Gene PubMed Count 31
PubMed Score 106.36
PubTator Score 42.45

Knowledge Summary

Patent

No data available

Gene RIF (11)

PMID Text
26565624 HOXB1 functions as a tumor suppressor, regulated by miR-3175 in glioma.
22770981 The resulting phenotype includes bilateral facial palsy, hearing loss, and strabismus and correlates extensively with the previously reported Hoxb1(-/-) mouse phenotype.
21980499 HOXA1 A218G and HOXB1 nINS/INS variants may not contribute significantly to autism spectrum disorders risk
21433221 Hoxb1 Expression Induces Cell Fate Changes in the Trunk Neural Tube.
20678259 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20371328 analysis of a tethered-hopping model for protein-DNA binding and unbinding based on Sox2-Oct1-Hoxb1 ternary complex simulations
19477923 Data show that inducible Hox genes are selectively sensitive to the inhibition of actin polymerization and that actin polymerization is required for the assembly of a transcription complex on the regulatory region of the Hox genes.
17713478 UTX directly binds to the HOXB1 locus and is required for its activation
17167333 Variation not associated with autism in an Indian population.
11840501 It is unlikely that HoxB1 plays a significant role in the genetic predisposition to autism.
11069920 HoxB1 interacts with Pax6 and enhances its transcriptional activity. This interaction was modeled on a demonstrated interaction between zebrafish Pax6 and human HoxB1.

AA Sequence

MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPS      1 - 70
TLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQ     71 - 140
HPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF    141 - 210
TTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAA    211 - 280
GDASDQSTCTSPEASPSSVTS                                                     281 - 301
//

Text Mined References (33)

PMID Year Title
26565624 2015 HOXB1 Is a Tumor Suppressor Gene Regulated by miR-3175 in Glioma.
22770981 2012 HOXB1 founder mutation in humans recapitulates the phenotype of Hoxb1-/- mice.
21980499 2011 An integrated meta-analysis of two variants in HOXA1/HOXB1 and their effect on the risk of autism spectrum disorders.
21433221 2011 Anterior Hox genes interact with components of the neural crest specification network to induce neural crest fates.
20678259 2010 Candidate gene study of HOXB1 in autism spectrum disorder.
20371328 2010 Tethered-hopping model for protein-DNA binding and unbinding based on Sox2-Oct1-Hoxb1 ternary complex simulations.
20195514 2010 Genome-wide association study reveals multiple loci associated with primary tooth development during infancy.
19477923 2009 Induction of HoxB transcription by retinoic acid requires actin polymerization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17713478 2007 UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.
17167333 2007 Lack of association of HOXA1 and HOXB1 variants with autism in the Indian population.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12487626 2003 Cross-talk between glucocorticoid and retinoic acid signals involving glucocorticoid receptor interaction with the homoeodomain protein Pbx1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11972344 2002 Characterization of PREP2, a paralog of PREP1, which defines a novel sub-family of the MEINOX TALE homeodomain transcription factors.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11840501 2002 Lack of association between HoxA1 and HoxB1 gene variants and autism in 110 multiplex families.
11278854 2001 The recruitment of SOX/OCT complexes and the differential activity of HOXA1 and HOXB1 modulate the Hoxb1 auto-regulatory enhancer function.
11091361 2000 Discovery of allelic variants of HOXA1 and HOXB1: genetic susceptibility to autism spectrum disorders.
11069920 2001 Superactivation of Pax6-mediated transactivation from paired domain-binding sites by dna-independent recruitment of different homeodomain proteins.
10671062 1998 A genetic polymorphism in the human HOXB1 homeobox gene implying a 9bp tandem repeat in the amino-terminal coding region. Mutations in brief no. 200. Online.
10373562 1999 Trimeric association of Hox and TALE homeodomain proteins mediates Hoxb2 hindbrain enhancer activity.
10331985 1999 Specification of distinct motor neuron identities by the singular activities of individual Hox genes.
10052460 1999 Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
9482740 1998 The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.
8646877 1996 Fine mapping of human HOX gene clusters.
8570656 1996 Restricted expression of homeobox genes distinguishes fetal from adult human smooth muscle cells.
7913891 1994 The thyroid transcription factor-1 gene is a candidate target for regulation by Hox proteins.
2576652 1989 Organization of human class I homeobox genes.
2574852 1989 The human HOX gene family.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.