Property Summary

NCBI Gene PubMed Count 15
PubMed Score 194.46
PubTator Score 31.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -2.100 5.4e-07
psoriasis -1.300 6.8e-04
osteosarcoma -1.361 2.5e-03
lung cancer -1.400 4.9e-03
posterior fossa group A ependymoma 2.000 3.6e-06
non-inflammatory breast cancer -1.200 4.7e-15

 GO Component (1)

Gene RIF (7)

PMID Text
26496426 The Hoxa2-mediated decay of RCHY1 involves both the 19S and 20S proteasome complexes
24243817 HOXA2 acts as a suppressor or TBP-antagonist to inhibit MMP-9 expression; while methylation-mediated inactivation of HOXA2 in NPC derepresses MMP-9 production and increases invasion of NPC cells.
23775976 we have identified a nonsense mutation (Q235*) in HOXA2 that segregates with bilateral nonsyndromic microtia and hearing loss through three generations of a family in an autosomal dominant pattern.
20542577 Lack of mutations in the coding region of HOXA2 among the sporadic microtia patients.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
18394579 A missense mutation in the HOXA2 in a consanguineous iranian family with bilateral microtia was reported.

AA Sequence

MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAG      1 - 70
GRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKESLEIADGSG     71 - 140
GGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNS    141 - 210
EGKCKSLEDSEKVEEDEEEKTLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQSFPVSPLTSN    211 - 280
EKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAVSPSLPGSLDS    281 - 350
PVDISADSLDFFTDTLTTIDLQHLNY                                                351 - 376
//

Text Mined References (16)

PMID Year Title
26496426 2015 Molecular Analysis of the HOXA2-Dependent Degradation of RCHY1.
24243817 2013 Aberrantly hypermethylated Homeobox A2 derepresses metalloproteinase-9 through TBP and promotes invasion in Nasopharyngeal carcinoma.
23775976 2013 HOXA2 haploinsufficiency in dominant bilateral microtia and hearing loss.
20542577 2010 Mutational analysis of HOXA2 and SIX2 in a Bronx population with isolated microtia.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18394579 2008 A mutation in HOXA2 is responsible for autosomal-recessive microtia in an Iranian family.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
8646877 1996 Fine mapping of human HOX gene clusters.
1358459 1992 Vertebrate homeobox gene nomenclature.