Property Summary

NCBI Gene PubMed Count 17
PubMed Score 198.46
PubTator Score 31.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.200 1.4e-15
lung cancer -1.400 4.9e-03
malignant mesothelioma -2.100 5.4e-07
osteosarcoma -1.361 2.5e-03
posterior fossa group A ependymoma 2.000 3.6e-06
psoriasis -1.300 6.8e-04

Gene RIF (9)

AA Sequence

MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAG      1 - 70
GRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKESLEIADGSG     71 - 140
GGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNS    141 - 210
EGKCKSLEDSEKVEEDEEEKTLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQSFPVSPLTSN    211 - 280
EKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAVSPSLPGSLDS    281 - 350
PVDISADSLDFFTDTLTTIDLQHLNY                                                351 - 376
//

Text Mined References (18)

PMID Year Title