Property Summary

NCBI Gene PubMed Count 49
PubMed Score 81.18
PubTator Score 64.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.700 1.9e-08
osteosarcoma 1.124 4.5e-02
adrenocortical carcinoma 1.089 9.4e-03
interstitial cystitis -1.500 1.2e-03
psoriasis -1.100 2.4e-30

Gene RIF (30)

PMID Text
26552702 Regulated HOXA10 and HOXA11 expression is necessary for endometrial receptivity; decreased HOXA10 or HOXA11 expression leads to decreased implantation rates. Alternation of HOXA10 and HOXA11 expression has been identified as a mechanism of the decreased implantation associated with endometriosis, polycystic ovarian syndrome, leiomyoma, polyps, adenomyosis, and hydrosalpinx.
26056923 Laparoscopic endometrioma resection increases peri-implantation endometrial HOXA-11 mRNA expression.
25630974 The overexpression of miR-30d or 181a suppressed HOXA11 mRNA.
25590359 Epigenetic silencing of HOXA11 promotes gastric cancer proliferation, migration and invasion through activation of Wnt signaling.
24745830 Mutations in the coding region of HOXA11 are not common in Chinese women with Mullerian duct anomalies.
24306662 Low HOXA11 expression is associated with hepatocellular carcinoma.
24259349 Study suggests that HOXA11 hypermethylation may contribute to the progression of NSCLC by promoting cell proliferation or migration.
23979130 Lower expression of HOXA11 is associated with endometriosis-associated infertility.
23624749 Promoter methylation of HOXA11 is associated with glioblastoma.
22251480 Data show that up-regulation of the HOXA7, HOXA9, HOXA11, and PBX3 resulting from the down-regulation of miR-181 family members probably contribute to the poor prognosis of patients with nonfavorable cytogenetically abnormal AML (CA-AML).
22233680 reduced HOXA11 expression may contribute to endometriosis-associated infertility
21987111 Endometrial HOXA11 and LIF mRNA expression levels (normalized to beta-actin expression) were significantly decreased in endometrium of infertile patients with endometriosis compared with healthy fertile controls
21526497 The result suggest that HOXA-11 gene expression in the endometrium during the implantation window may not be altered in patients with idiopathic infertility.
20695189 Our results suggest that altered HOXA11 gene expression in the endometrium during a menstrual cycle may be a common phenomenon among patients with endometriosis and may cause infertility in this group of patients
20457539 No subject with female genital tract anomalies showed a plausible causative mutation in HOX A10 or HOX A11.
20457539 Observational study of gene-disease association. (HuGE Navigator)
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19727442 HoxA-11 is required for prolactin expression in decidualized embryonic stem cells and turns into an activator when combined with FOXO1A; HOXA-10 is unable to upregulate PRL expression when co-expressed with FOXO1A
19609949 Methylation of HOXA11 gene is associated with high-grade squamous intraepithelial lesions in cervical cancer
19453261 Observational study of gene-disease association. (HuGE Navigator)
19372592 Expression of HOXA11 represses the expression of p53 in uterosacral ligaments.
19255789 Our findings do not support the hypothesis that mutations in the HOXA11 coding regions are involved in the pathogenesis of human non-syndromal congenital renal parenchymal malformations.
19255789 Observational study of gene-disease association. (HuGE Navigator)
18274672 HOXA11 is critical for development and maintenance of uterosacral ligaments and deficient in pelvic prolapse.
15731295 HOXA10 and HOXA11 expression increases during the menstrual cycle, increasing drastically in the midluteal phase, at the time of implantation.
15674412 The HOXA11 gene cluster is in T-cell malignancies resulting in deregulated HOXA gene expression and is in keeping with a previous report suggesting HOXA deregulation in MLL-rearranged T cell lymphoblastic leukemia.
15467538 study reveals a novel expression pattern for homeo box A11(HOXA11) gene in human endometrium
15167850 HOXA gene expression is up-regulated at the ectopic implantation site in the fallopian tube and it may play a role in ectopic pregnancies.
12060755 expressed in the developing kidney
11830496 NUP98 primer and a degenerate primer corresponding to the third helix of the homeodomain of HOXA demonstrated that NUP98 was fused in-frame to HOXA11 in the patient with CML ( chronic myelogenous leukemia)

AA Sequence

MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPA      1 - 70
TKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAF     71 - 140
DQFFETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAAAAATGAPATSSSDSGGGGGCRETAAAAEEK    141 - 210
ERRRRPESSSSPESSSGHTEDKAGGSSGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNL    211 - 280
TDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL                                         281 - 313
//

Text Mined References (49)

PMID Year Title
26552702 2015 The Role of Hox Genes in Female Reproductive Tract Development, Adult Function, and Fertility.
26056923 2015 Laparoscopic endometrioma resection increases peri-implantation endometrial HOXA-10 and HOXA-11 mRNA expression.
25630974 2015 MicroRNA-30d and microRNA-181a regulate HOXA11 expression in the uterosacral ligaments and are overexpressed in pelvic organ prolapse.
25590359 2015 Epigenetic changes and functional study of HOXA11 in human gastric cancer.
24745830 2014 Mutations in HOXA11 are not responsible for Müllerian duct anomalies in Chinese patients.
24306662 2014 DNA methylation profiling identifies EYA4 gene as a prognostic molecular marker in hepatocellular carcinoma.
24259349 2013 HOXA11 hypermethylation is associated with progression of non-small cell lung cancer.
23979130 2013 HOXA-11 mediated dysregulation of matrix remodeling during implantation window in women with endometriosis.
23624749 2013 Promoter methylation of AREG, HOXA11, hMLH1, NDRG2, NPTX2 and Tes genes in glioblastoma.
22251480 2012 Up-regulation of a HOXA-PBX3 homeobox-gene signature following down-regulation of miR-181 is associated with adverse prognosis in patients with cytogenetically abnormal AML.
22233680 2012 Expression of HOXA11 in the mid-luteal endometrium from women with endometriosis-associated infertility.
21987111 2011 Semi-quantitative analysis of HOXA11, leukemia inhibitory factor and basic transcriptional element binding protein 1 mRNA expression in the mid-secretory endometrium of patients with endometriosis.
21526497 2011 Expression of HOXA-10 and HOXA-11 in the endometria of women with idiopathic infertility.
20695189 2010 [HOXA11 gene expression in women with and without impaired infertility].
20457539 2010 HOX A10 and HOX A11 mutation scan in congenital malformations of the female genital tract.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19727442 2009 HoxA-11 and FOXO1A cooperate to regulate decidual prolactin expression: towards inferring the core transcriptional regulators of decidual genes.
19609949 2009 DNA methylation analysis in liquid-based cytology for cervical cancer screening.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19372592 2009 HOXA11 promotes fibroblast proliferation and regulates p53 in uterosacral ligaments.
19255789 2009 Absence of mutations in the HOXA11 and HOXD11 genes in children with congenital renal malformations.
18274672 2008 HOXA11 is critical for development and maintenance of uterosacral ligaments and deficient in pelvic prolapse.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15731295 2004 The role of HOX genes in human implantation.
15674412 2005 A new recurrent inversion, inv(7)(p15q34), leads to transcriptional activation of HOXA10 and HOXA11 in a subset of T-cell acute lymphoblastic leukemias.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467538 2004 Expression of HOXA11 gene in human endometrium.
15167850 2004 HOXA10 gene expression in human fallopian tube and ectopic pregnancy.
14973489 2004 The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12060755 2002 Hoxa 11 is upstream of Integrin alpha8 expression in the developing kidney.
12050232 2002 HOXA11 silencing and endogenous HOXA11 antisense ribonucleic acid in the uterine endometrium.
11937757 2002 Genes and proteins in renal development.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11841440 2002 Absence of mutations in the HoxA10, HoxA11 and HoxD11 nucleotide coding sequences in thrombocytopenia with absent radius syndrome.
11830496 2002 Single-translocation and double-chimeric transcripts: detection of NUP98-HOXA9 in myeloid leukemias with HOXA11 or HOXA13 breaks of the chromosomal translocation t(7;11)(p15;p15).
11585930 2001 The HOX homeodomain proteins block CBP histone acetyltransferase activity.
11396649 2001 Molecular markers of implantation: clinical implications.
11299969 2000 Implantation in the human: the role of HOX genes.
11101832 2000 Amegakaryocytic thrombocytopenia and radio-ulnar synostosis are associated with HOXA11 mutation.
10084606 1999 Sex steroids mediate HOXA11 expression in the human peri-implantation endometrium.
9745033 1998 Evolutionary conservation and tissue-specific processing of Hoxa 11 antisense transcripts.
8646877 1996 Fine mapping of human HOX gene clusters.
8570656 1996 Restricted expression of homeobox genes distinguishes fetal from adult human smooth muscle cells.
2574852 1989 The human HOX gene family.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.