| Tbio | Homeobox protein Hox-A1 |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments.
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq, Jul 2008]
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Athabaskan brainstem dysgenesis | 1 | 0.0 | 0.0 |
| Autistic Disorder | 364 | 0.0 | 0.0 |
| Craniofacial Abnormalities | 151 | 0.0 | 0.0 |
| Heart Defects, Congenital | 37 | 0.0 | 0.0 |
| Nervous System Malformations | 10 | 0.0 | 0.0 |
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2890 | 2.8e-11 |
| Breast cancer | 3578 | 1.3e-08 |
| posterior fossa group A ependymoma | 468 | 2.2e-07 |
| adult high grade glioma | 3801 | 4.9e-05 |
| cystic fibrosis | 1696 | 6.5e-04 |
| interstitial cystitis | 2312 | 1.1e-03 |
| glioblastoma | 5792 | 2.7e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Hantavirus pulmonary syndrome | 6 | 4.119 | 2.1 |
| Congenital fibrosis of the extraocular muscles | 13 | 3.68 | 1.8 |
| Tethered spinal cord syndrome | 11 | 3.304 | 1.7 |
| Disease | Target Count |
|---|---|
| Athabaskan Brainstem Dysgenesis Syndrome | 1 |
| Disease | log2 FC | p |
|---|---|---|
| adult high grade glioma | 1.900 | 4.9e-05 |
| Breast cancer | -1.100 | 1.3e-08 |
| cystic fibrosis | 1.300 | 6.5e-04 |
| glioblastoma | 1.100 | 2.7e-02 |
| interstitial cystitis | -2.100 | 1.1e-03 |
| non-small cell lung cancer | 1.486 | 2.8e-11 |
| posterior fossa group A ependymoma | 1.500 | 2.2e-07 |
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHH 1 - 70 HHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMV 71 - 140 QHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKV 141 - 210 KRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNR 211 - 280 RMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH 281 - 335 //
