Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.05
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N7B1 B5MEB2 Q8NHR2
Symbols CT46.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MATAQLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKI      1 - 70
LREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSS     71 - 140
STSFESGTNNEDIKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLL    141 - 210
FDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFV    211 - 280
CSQQSSECSRKKRKVSEPVKVFIPNRK                                               281 - 307
//

Text Mined References (14)

PMID Year Title