Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.05
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MATAQLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKI      1 - 70
LREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSS     71 - 140
STSFESGTNNEDIKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLL    141 - 210
FDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFV    211 - 280
CSQQSSECSRKKRKVSEPVKVFIPNRK                                               281 - 307
//

Text Mined References (14)

PMID Year Title