Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.64
PubTator Score 9.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -3.000 1.2e-03
posterior fossa group A ependymoma -3.500 1.5e-12
oligodendroglioma -2.700 8.4e-03
glioblastoma -4.600 2.5e-06
osteosarcoma -1.830 1.2e-02
sonic hedgehog group medulloblastoma -3.500 3.3e-06
atypical teratoid / rhabdoid tumor -2.900 9.1e-04
medulloblastoma, large-cell -2.100 7.2e-05
primitive neuroectodermal tumor -3.000 9.6e-04
pancreatic ductal adenocarcinoma liver m... -2.974 4.0e-04
non-small cell lung carcinoma 1.200 4.0e-20
lung cancer 1.800 9.4e-04
interstitial cystitis -1.500 7.9e-04
adult high grade glioma -4.100 1.4e-06
pilocytic astrocytoma -3.800 2.1e-09
subependymal giant cell astrocytoma -2.453 3.4e-02
lung carcinoma 2.800 7.1e-29
spina bifida -1.782 3.6e-02
ductal carcinoma in situ 1.500 1.9e-02
invasive ductal carcinoma 2.500 7.0e-03
acute myeloid leukemia -1.300 2.2e-02
pancreatic cancer -1.100 1.6e-02

Gene RIF (5)

PMID Text
25331952 SHP2 positively regulates TGFbeta1-induced epithelial-mesenchymal transition modulated by its novel interacting protein Hook1.
23589492 Hook1, a microtubule- and cargo-tethering protein, recognized the cytoplasmic tail of CD147 to help sort it and CD98 into Rab22a-dependent tubules associated with recycling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18799622 These data suggest that the FTS/Hook/FHIP complex functions to promote vesicle trafficking and/or fusion via the homotypic vacuolar protein sorting complex.
15471887 novel interactions between the microtubule-binding Hook1 and the large family of Rab GTPases also suggest a link between CLN3 function, microtubule cytoskeleton and endocytic membrane trafficking

AA Sequence

MEETQPPPQPKLPLCDSLMIWLQTFNTASPCQDVKQLTSGVAMAQVLHQIDAAWFNESWLSRIKEDVGDN      1 - 70
WRIKASNVKKVLQGIMSYYHEFLGQQISEALIPDLNQITECSDPVELGRLLQLILGCAINCEKKQEHIQN     71 - 140
IMTLEESVQHVVMTAIQELMSKEILSSPPNDAVGELEQQLKRALEELQEALAEKEELRQRCEELDMQVTT    141 - 210
LQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHCEELEK    211 - 280
QLIEFQHRNDELTSLAEETRALKDEIDVLRATSDKANKLESTVEIYRQKLQDLNDLRKQVKTLQETNMMY    281 - 350
MHNTVSLEEELKKANAARTQLETYKRQVQDLHVKLSSESKRADTLAFEMKRLEEKHEALLKEKERLIEQR    351 - 420
DTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIE    421 - 490
ELQEQLEQKHRKMNELETEQRLSKERIRELQQQIEDLQKSLQEQGSKSEGESSSKLKQKLEAHMEKLTEV    491 - 560
HEELQKKQELIEDLQPDINQNVQKINELEAALQKKDEDMKAMEERYKMYLEKARNVIKTLDPKLNPASAE    561 - 630
IMLLRKQLAEKERRIEILESECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTP    631 - 700
ARSFLAQQRHITNTRRNLSVKVPATTSD                                              701 - 728
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25331952 2014 SHP2 positively regulates TGF?1-induced epithelial-mesenchymal transition modulated by its novel interacting protein Hook1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23589492 2013 Microtubule-dependent endosomal sorting of clathrin-independent cargo by Hook1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18799622 2008 An FTS/Hook/p107(FHIP) complex interacts with and promotes endosomal clustering by the homotypic vacuolar protein sorting complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15882442 2005 A novel hook-related protein family and the characterization of hook-related protein 1.
15823567 2005 Elevation of Hook1 in a disease model of Batten disease does not affect a novel interaction between Ankyrin G and Hook1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471887 2004 Interconnections of CLN3, Hook1 and Rab proteins link Batten disease to defects in the endocytic pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12075009 2002 The Hook1 gene is non-functional in the abnormal spermatozoon head shape (azh) mutant mouse.
11238449 2001 The Golgi-associated hook3 protein is a member of a novel family of microtubule-binding proteins.
9927460 1999 Genetic analysis of hook, a gene required for endocytic trafficking in drosophila.