Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.40
PubTator Score 9.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.500 9.7e-07
psoriasis 2.700 7.5e-05
astrocytoma 1.100 1.1e-15
glioblastoma multiforme 1.400 2.9e-25
non-small cell lung cancer 1.131 1.5e-15
nasopharyngeal carcinoma 1.200 4.7e-03
ovarian cancer 1.300 1.2e-04
Breast cancer 1.200 8.1e-06
Gaucher disease type 1 -1.100 4.9e-02
cystic fibrosis and chronic rhinosinusit... 1.007 2.3e-02
dermatomyositis -1.100 1.8e-02

Gene RIF (8)

PMID Text
25739453 Homer3 acts as a scaffold that spatially organizes actin assembly to support neutrophil polarity and motility downstream of GPCR activation.
24792907 Interaction of the protein with amyloid precursor protein is regulated by calcium homeostasis.
23725168 Loss of Homer3 is associated with acute myeloid leukemia.
20693425 Homer3 specifically associates with a novel ubiquitin-like domain in the I kappa B kinase (IKK) beta subunit of the IKK complex.
18218901 study found that Homer2 and Homer3 are negative regulators of T cell activation; this is achieved through binding of nuclear factor of activated T cells (NFAT) and by competing with calcineurin
16979624 Fat1 exhibit co-localisation with Homer-3 in cellular protrusions and at the plasma membrane of HeLa cells
14645007 Homer-3 may be involved in the regulation of SRE activation in T cells via interaction between its EVH1 domain and C/EBP beta.
12815733 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF      1 - 70
TKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKSQDGGELTSPALGLASHQVPP     71 - 140
SPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSVGEVQWEAEFFALQDSNNKLAGALREANAAA    141 - 210
AQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGG    211 - 280
PREALEAAEREETQQKVQDLETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELR    281 - 350
EGLARLAEAAP                                                               351 - 361
//

Text Mined References (22)

PMID Year Title
25739453 2015 Homer3 regulates the establishment of neutrophil polarity.
24792907 2014 Calcium regulates the interaction of amyloid precursor protein with Homer3 protein.
23725168 2013 Growth and differentiation effects of Homer3 on a leukemia cell line.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20693425 2010 Cutting edge: association with I kappa B kinase beta regulates the subcellular localization of Homer3.
19345194 2009 The postsynaptic density proteins Homer and Shank form a polymeric network structure.
19060904 2009 An empirical framework for binary interactome mapping.
18387811 2008 Homer2 and Homer3 interact with amyloid precursor protein and inhibit Abeta production.
18218901 2008 NFAT binding and regulation of T cell activation by the cytoplasmic scaffolding Homer proteins.
16979624 2006 The intracellular domain of the human protocadherin hFat1 interacts with Homer signalling scaffolding proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14645007 2004 Homer-3 regulates activation of serum response element in T cells via its EVH1 domain.
12815733 2003 Mutation screening of the Homer gene family and association analysis in schizophrenia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12223488 2002 Homer regulates gain of ryanodine receptor type 1 channel complex.
10653696 2000 Molecular characterisation of two structurally distinct groups of human homers, generated by extensive alternative splicing.
9808459 1998 Homer binds a novel proline-rich motif and links group 1 metabotropic glutamate receptors with IP3 receptors.
9808458 1998 Homer regulates the association of group 1 metabotropic glutamate receptors with multivalent complexes of homer-related, synaptic proteins.
9069287 1997 Homer: a protein that selectively binds metabotropic glutamate receptors.