Property Summary

NCBI Gene PubMed Count 24
PubMed Score 42.63
PubTator Score 88.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.200 2.4e-02
esophageal adenocarcinoma -1.300 1.9e-02
glioblastoma -1.500 2.7e-06
cystic fibrosis 1.329 1.9e-05
acute quadriplegic myopathy -1.363 3.6e-06
primary pancreatic ductal adenocarcinoma -2.063 1.2e-02
intraductal papillary-mucinous adenoma (... -2.000 1.5e-03
intraductal papillary-mucinous carcinoma... -3.500 1.4e-04
intraductal papillary-mucinous neoplasm ... -3.300 1.0e-03
lung cancer 2.000 4.2e-04
pancreatic cancer -1.900 3.9e-03
adult high grade glioma -1.600 1.5e-03
pilocytic astrocytoma -2.400 2.4e-08
posterior fossa group A ependymoma -1.100 3.0e-04
Endometriosis -1.245 2.2e-02
Breast cancer -2.400 3.4e-15
gastric carcinoma -2.100 3.5e-02
invasive ductal carcinoma 1.400 4.7e-02
ovarian cancer 1.600 1.3e-05

Protein-protein Interaction (6)

Gene RIF (12)

PMID Text
25816005 These data provide compelling evidence that HOMER2 is required for normal hearing and that its sequence alteration in humans leads to ADNSHL through a dominant-negative mode of action
25649652 This study showed that HOMER2 (rs1256429; intronic, p = 8.7 x 10(1)) associated with Alzheimer disease.
21885651 monitored Homer1 and Homer2 expression and subcellular localization in skeletal muscle biopsies following 60 days of bedrest
20333726 Haplotypes of the HOMER 1 and 2 genes are unlikely to play a major role in the pathophysiology of alcohol dependence.
20333726 Observational study of gene-disease association. (HuGE Navigator)
19914345 This study supports a role for HOMER2 gene in schizophrenia susceptibility.
19914345 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18218901 study found that Homer2 and Homer3 are negative regulators of T cell activation; this is achieved through binding of nuclear factor of activated T cells (NFAT) and by competing with calcineurin
16314758 Observational study of gene-disease association. (HuGE Navigator)
16314758 Polymorphism in the Homer2 gene is not a potential risk factor for the development of cocaine dependence in an African American population.
12815733 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT      1 - 70
SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ     71 - 140
ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQ    141 - 210
WKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQL    211 - 280
MSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKL    281 - 350
GTDN                                                                      351 - 354
//

Text Mined References (25)

PMID Year Title
25816005 2015 HOMER2, a stereociliary scaffolding protein, is essential for normal hearing in humans and mice.
25649652 2015 Linking Genetics of Brain Changes to Alzheimer's Disease: Sparse Whole Genome Association Scan of Regional MRI Volumes in the ADNI and AddNeuroMed Cohorts.
25416956 2014 A proteome-scale map of the human interactome network.
21885651 2011 Expression and regulation of Homer in human skeletal muscle during neuromuscular junction adaptation to disuse and exercise.
21636702 2011 Novel candidate colorectal cancer biomarkers identified by methylation microarray-based scanning.
20921022 2010 Recurrent microdeletions of 15q25.2 are associated with increased risk of congenital diaphragmatic hernia, cognitive deficits and possibly Diamond--Blackfan anaemia.
20531441 2010 CAMOS, a nonprogressive, autosomal recessive, congenital cerebellar ataxia, is caused by a mutant zinc-finger protein, ZNF592.
20333726 2010 No association of alcohol dependence with HOMER 1 and 2 genetic variants.
19914345 2010 Replicated genetic evidence supports a role for HOMER2 in schizophrenia.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18387811 2008 Homer2 and Homer3 interact with amyloid precursor protein and inhibit Abeta production.
18218901 2008 NFAT binding and regulation of T cell activation by the cytoplasmic scaffolding Homer proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16314758 2005 Association of a polymorphism in the Homer1 gene with cocaine dependence in an African American population.
15944415 2005 A novel protein specifically interacting with Homer2 regulates ubiquitin-proteasome systems.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12815733 2003 Mutation screening of the Homer gene family and association analysis in schizophrenia.
12676529 2003 Coincidence in dendritic clustering and synaptic targeting of homer proteins and NMDA receptor complex proteins NR2B and PSD95 during development of cultured hippocampal neurons.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12378015 2002 Potential role of Homer-2a on cutaneous vascular anomaly.
10653696 2000 Molecular characterisation of two structurally distinct groups of human homers, generated by extensive alternative splicing.
9808459 1998 Homer binds a novel proline-rich motif and links group 1 metabotropic glutamate receptors with IP3 receptors.
9808458 1998 Homer regulates the association of group 1 metabotropic glutamate receptors with multivalent complexes of homer-related, synaptic proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.