Property Summary

NCBI Gene PubMed Count 52
PubMed Score 267.35
PubTator Score 97.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
interstitial lung disease -1.100 4.1e-02
astrocytic glioma -2.200 1.1e-03
ependymoma -3.200 2.7e-03
oligodendroglioma -1.700 6.5e-03
psoriasis 1.300 3.2e-65
glioblastoma -2.300 3.3e-07
osteosarcoma 1.804 9.0e-03
medulloblastoma -1.900 8.1e-06
atypical teratoid / rhabdoid tumor -2.600 6.7e-09
medulloblastoma, large-cell -1.800 3.0e-04
primitive neuroectodermal tumor -1.900 8.4e-04
Amyotrophic Lateral Sclerosis 1.028 6.7e-04
Atopic dermatitis 1.100 1.2e-04
adrenocortical carcinoma 1.887 1.1e-03
tuberculosis -1.600 3.0e-05
colon cancer 2.000 1.0e-04
lung cancer 2.600 6.4e-05
active Crohn's disease 1.427 3.3e-02
ulcerative colitis 1.400 1.1e-05
diabetes mellitus -1.200 2.7e-03
interstitial cystitis -1.400 2.5e-03
adult high grade glioma -2.000 1.0e-03
pilocytic astrocytoma -1.700 2.3e-05
progressive supranuclear palsy 1.300 9.2e-03
Breast cancer -1.500 1.7e-12
gastric carcinoma 1.700 4.9e-02
ductal carcinoma in situ 1.500 1.4e-03
Down syndrome -1.400 1.1e-03

Gene RIF (30)

PMID Text
26718835 The present study was undertaken to determine the expression and functional significance of Homer1b/c in multiple myeloma
26641965 The main focus of the present review is to offer an overview of the current knowledge about the potential role of Homer1a in depression and the signaling pathways responsible for Homer1a regulation. [review]
25712868 these findings provide evidence for a new role of Homer1 supporting the regulation of Cav1.2 channels by STIM1.
25551602 The mRNA levels of Homer1, IL-1beta, and TNF-alpha in coronary artery disease patients were significantly higher than those in the control group, but not Homer2 and Homer3.
24815486 Homer1 promotes lymphatic invasion and associates with lymph node metastasis and poor prognosis of intrahepatic cholangiocarcinoma.
24126708 data suggest that HOMER1 rs4704559 G allele has a protective role for the development of levodopa adverse effects
23821062 The uncoupling of synaptic protein homer 1c from target proteins activates store-operated calcium entry in a neurotransmitter-like manner in human neuroblastoma cells.
23685007 Overexpression of HOMER1A reduces neuropathic pain hypersensitivity.
23044706 Polymorphisms of DRD1, DLG4 and HOMER1 are associated with opiate abuse.
22749857 This review discusses the association of Homer 1 variants with the etiology of many neurological diseases, such as pain, mental retardation syndromes, Alzheimer's disease, schizophrenia, addiction and traumatic brain injury.
22558107 HOMER1 encodes a postsynaptic density-localized scaffolding protein that interacts with Shank3 to regulate mGluR activity, and is a novel autism-risk gene.
21885651 monitored Homer1 and Homer2 expression and subcellular localization in skeletal muscle biopsies following 60 days of bedrest
21172614 Homer1a transgene expression is transiently upregulated during increases in network activity and evokes agonist-independent signaling of group I metabotropic glutamate receptors that scales down expression of synaptic AMPA receptors.
20926133 Homer dissociation from its targets evoked by the PPKKFR peptide led to Imin calcium channel activation but not to Imax calcium channel activation in A431 cells.
20673876 HOMER1 plays a role in the etiology of major depression and genetic variation affects depression via the dysregulation of cognitive and motivational processes.
20673876 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20598711 This study reported significant associations between different polymorphisms of the HOMER 1 gene and psychopathology of schizophrenic patients at baseline and between HOMER 1 polymorphisms and therapy response after treatment with atypical antipsychotics.
20598711 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20333726 Haplotypes of the HOMER 1 and 2 genes are unlikely to play a major role in the pathophysiology of alcohol dependence.
20333726 Observational study of gene-disease association. (HuGE Navigator)
19648775 study implicates the effects of allele A of the rs4704559 marker in susceptibility to psychotic symptoms in Parkinson disease
19648775 Observational study of gene-disease association. (HuGE Navigator)
19376111 Data indicate that Homer1 plays a critical role in determining the apoptotic susceptibility to TRAIL.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19086053 Observational study of gene-disease association. (HuGE Navigator)
16314758 Observational study of gene-disease association. (HuGE Navigator)
16314758 Polymorphism in the Homer1 gene is a potential risk factor for the development of cocaine dependence in an African American population.
12815733 Observational study of gene-disease association. (HuGE Navigator)
12815733 HOMER1 was screened for an association with schizophrenia.

AA Sequence

MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKT      1 - 70
SQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPL     71 - 140
TPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATLKGNNAKLTAALLESTANVKQ    141 - 210
WKQQLAAYQEEAERLHKRVTELECVSSQANAVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNAREL    211 - 280
QEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKL    281 - 350
LECS                                                                      351 - 354
//

Text Mined References (54)

PMID Year Title
26718835 2016 Cell adhesion downregulates the expression of Homer1b/c and contributes to drug resistance in multiple myeloma cells.
26641965 2016 Signaling pathways regulating Homer1a expression: implications for antidepressant therapy.
25712868 2015 Homer proteins mediate the interaction between STIM1 and Cav1.2 channels.
25551602 2014 Diagnostic potential of differentially expressed Homer1, IL-1?, and TNF-? in coronary artery disease.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
24815486 2014 Identification of Homer1 as a potential prognostic marker for intrahepatic cholangiocarcinoma.
24126708 2014 Association of common genetic variants of HOMER1 gene with levodopa adverse effects in Parkinson's disease patients.
23821062 2013 The uncoupling of synaptic protein homer 1c from target proteins activates store-operated calcium entry in a neurotransmitter-like manner in human neuroblastoma cells.
23685007 2013 Nerve injury-induced changes in Homer/glutamate receptor signaling contribute to the development and maintenance of neuropathic pain.
23044706 2013 Dopamine receptor D1 and postsynaptic density gene variants associate with opiate abuse and striatal expression levels.
22749857 2012 Scaffold protein Homer 1: implications for neurological diseases.
22558107 2012 High-throughput sequencing of mGluR signaling pathway genes reveals enrichment of rare variants in autism.
21885651 2011 Expression and regulation of Homer in human skeletal muscle during neuromuscular junction adaptation to disuse and exercise.
21269460 2011 Initial characterization of the human central proteome.
21172614 2010 Homeostatic scaling requires group I mGluR activation mediated by Homer1a.
20926133 2010 Homer regulation of native plasma membrane calcium channels in A431 cells.
20673876 2010 Genome-wide association-, replication-, and neuroimaging study implicates HOMER1 in the etiology of major depression.
20598711 2011 Homer-1 polymorphisms are associated with psychopathology and response to treatment in schizophrenic patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20333726 2010 No association of alcohol dependence with HOMER 1 and 2 genetic variants.
19648775 2009 HOMER1 promoter analysis in Parkinson's disease: association study with psychotic symptoms.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19376111 2009 Homer1 regulates the susceptibility to TRAIL.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18193045 2008 Common variants in the GDF5-UQCC region are associated with variation in human height.
16314758 2005 Association of a polymorphism in the Homer1 gene with cocaine dependence in an African American population.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15745950 2005 Interactions between ephrin-B and metabotropic glutamate 1 receptors in brain tissue and cultured neurons.
15691715 2005 AAV-mediated hippocampal expression of short and long Homer 1 proteins differentially affect cognition and seizure activity in adult rats.
15673434 2005 A novel scaffold protein, TANC, possibly a rat homolog of Drosophila rolling pebbles (rols), forms a multiprotein complex with various postsynaptic density proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15033484 2004 Topology of Homer 1c and Homer 1a in C2C12 myotubes and transgenic skeletal muscle fibers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660561 2004 Homer protein increases activation of Ca2+ sparks in permeabilized skeletal muscle.
14528310 2003 PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis.
14505576 2003 Homer binds TRPC family channels and is required for gating of TRPC1 by IP3 receptors.
12887973 2003 Vesl/Homer proteins regulate ryanodine receptor type 2 function and intracellular calcium signaling.
12815733 2003 Mutation screening of the Homer gene family and association analysis in schizophrenia.
12810060 2003 Differential functional interaction of two Vesl/Homer protein isoforms with ryanodine receptor type 1: a novel mechanism for control of intracellular calcium signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12223488 2002 Homer regulates gain of ryanodine receptor type 1 channel complex.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11418862 2001 Agonist-independent activation of metabotropic glutamate receptors by the intracellular protein Homer.
10851183 2000 Homer: a link between neural activity and glutamate receptor function.
10833436 2000 Interaction of Vesl-1L/Homer 1c with syntaxin 13.
10464340 1999 Homer 1b regulates the trafficking of group I metabotropic glutamate receptors.
10433269 1999 Coupling of mGluR/Homer and PSD-95 complexes by the Shank family of postsynaptic density proteins.
9808459 1998 Homer binds a novel proline-rich motif and links group 1 metabotropic glutamate receptors with IP3 receptors.
9808458 1998 Homer regulates the association of group 1 metabotropic glutamate receptors with multivalent complexes of homer-related, synaptic proteins.
9069287 1997 Homer: a protein that selectively binds metabotropic glutamate receptors.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.