Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.73
PubTator Score 22.01

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MLGPQVWSSVRQGLSRSLSRNVGVWASGEGKKVDIAGIYPPVTTPFTATAEVDYGKLEENLHKLGTFPFR      1 - 70
GFVVQGSNGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCY     71 - 140
YRGRMSSAALIHHYTKVADLSPIPVVLYSVPANTGLDLPVDAVVTLSQHPNIVGMKDSGGDVTRIGLIVH    141 - 210
KTRKQDFQVLAGSAGFLMASYALGAVGGVCALANVLGAQVCQLERLCCTGQWEDAQKLQHRLIEPNAAVT    211 - 280
RRFGIPGLKKIMDWFGYYGGPCRAPLQELSPAEEEALRMDFTSNGWL                           281 - 327
//

Text Mined References (18)

PMID Year Title