Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.33
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 2.0e-03
atypical teratoid / rhabdoid tumor -1.300 1.4e-04
glioblastoma -1.100 9.9e-04
medulloblastoma, large-cell -1.300 3.2e-05
osteosarcoma -1.645 8.5e-08
ovarian cancer -1.400 6.6e-05
primary pancreatic ductal adenocarcinoma 1.182 1.0e-02
psoriasis -1.500 6.0e-05
Rheumatoid arthritis 1.500 1.5e-04
subependymal giant cell astrocytoma -1.441 9.2e-03

Gene RIF (1)

AA Sequence

MEVKRLKVTELRSELQRRGLDSRGLKVDLAQRLQEALDAEMLEDEAGGGGAGPGGACKAEPRPVAASGGG      1 - 70
PGGDEEEDEEEEEEDEEALLEDEDEEPPPAQALGQAAQPPPEPPEAAAMEAAAEPDASEKPAEATAGSGG     71 - 140
VNGGEEQGLGKREEDEPEERSGDETPGSEVPGDKAAEEQGDDQDSEKSKPAGSDGERRGVKRQRDEKDEH    141 - 210
GRAYYEFREEAYHSRSKSPLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSG    211 - 280
ARSTYGVTKGKVCFEAKVTQNLPMKEGCTEVSLLRVGWSVDFSRPQLGEDEFSYGFDGRGLKAENGQFEE    281 - 350
FGQTFGENDVIGCFANFETEEVELSFSKNGEDLGVAFWISKDSLADRALLPHVLCKNCVVELNFGQKEEP    351 - 420
FFPPPEEFVFIHAVPVEERVRTAVPPKTIEECEVILMVGLPGSGKTQWALKYAKENPEKRYNVLGAETVL    421 - 490
NQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFILDQCNVYNSGQRRKLLLFKTFSRKVV    491 - 560
VVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLPEKCDYMDEVTYGELEKEEAQPIVTKYKEEAR    561 - 630
KLLPPSEKRTNRRNNRNKRNRQNRSRGQGYVGGQRRGYDNRAYGQQYWGQPGNRGGYRNFYDRYRGDYDR    631 - 700
FYGRDYEYNRYRDYYRQYNRDWQSYYYHHPQDRDRYYRNYYGYQGYR                           701 - 747
//

Text Mined References (12)

PMID Year Title