Property Summary

NCBI Gene PubMed Count 40
PubMed Score 11.11
PubTator Score 14.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.600 1.6e-03
ependymoma 2.100 1.1e-03
oligodendroglioma 1.600 2.7e-03
psoriasis -1.800 1.3e-04
osteosarcoma -1.053 1.6e-03
medulloblastoma 2.100 2.1e-05
atypical teratoid / rhabdoid tumor 2.000 1.6e-06
glioblastoma 2.000 6.1e-07
medulloblastoma, large-cell 2.300 5.7e-05
primitive neuroectodermal tumor 1.800 1.4e-05
pediatric high grade glioma 1.300 6.0e-05

Gene RIF (18)

PMID Text
26020839 we define the arginines within the RGG/RG motifs as the site of methylation by PRMT1 both in vitro and in vivo. The arginines within the human hnRNPUL1 RGG/RG motifs were substituted with lysines to generate hnRNPUL1(RK).
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that HNRNPUL1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with HNRNPUL1
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that HNRNPUL1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with HNRNPUL1
24595077 Despite the limitations, hnRPUL1 and PARP1 were downregulated in renal cell carcinoma and connected with the prognosis.
23577092 hnRPUL1 as a new component related to PARP1 in DNA damage response and repair
22451911 U7 snRNP represses histone gene transcription under cell cycle-arrested conditions. hnRNP UL1 is responsible for U7 snRNP-dependent transcriptional repression of replication-dependent histone genes.
22365830 hnRNPUL1 and -2 function downstream of MRN and CtBP-interacting protein (CtIP) to promote recruitment of the BLM helicase to DNA breaks.
21083500 E1B-AP5 is a novel surface molecule that is involved in the undifferentiated state of human embryonic stem cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19166692 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18599554 Observational study of gene-disease association. (HuGE Navigator)
18480432 Taken together, these results define a role for E1B-AP5 in ATR signaling pathways activated during adenovirus infection.
16690874 Observational study of gene-disease association. (HuGE Navigator)
16690874 Variants in 2 genes were associated with early-onset myocardial infarct: VAMP8, which is involved in platelet degranulation, and HNRPUL1, which encodes a ribonuclear protein.
12489984 Regulation of transcripton by this protein is mediated by complex formation with BRD7
9733834 Human E1B-AP5 binds to adenovirus E1B-55kDa protein.

AA Sequence

MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGS      1 - 70
ELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPE     71 - 140
MKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTL    141 - 210
VAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPH    211 - 280
VVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGK    281 - 350
WMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE    351 - 420
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNR    421 - 490
LIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLE    491 - 560
MKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYE    561 - 630
NRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQ    631 - 700
PPPPQPPPQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQG    701 - 770
YTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY    771 - 840
DYGSYSGNTQGGTSTQ                                                          841 - 856
//

Text Mined References (59)

PMID Year Title
26020839 2015 Arginine methylation of hnRNPUL1 regulates interaction with NBS1 and recruitment to sites of DNA damage.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24595077 2013 Heterogeneous nuclear ribonucleoprotein U-like 1 and Poly (ADP-ribose) polymerase 1 are downregulated in renal cell carcinoma and connected with the prognosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23577092 2013 The role of hnRPUL1 involved in DNA damage response is related to PARP1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22653443 2012 Mutant p53 interactome identifies nardilysin as a p53R273H-specific binding partner that promotes invasion.
22451911 2012 U7 small nuclear ribonucleoprotein represses histone gene transcription in cell cycle-arrested cells.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22365830 2012 Regulation of DNA-end resection by hnRNPU-like proteins promotes DNA double-strand break signaling and repair.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21083500 2011 Identification and characterization of adenovirus early region 1B-associated protein 5 as a surface marker on undifferentiated human embryonic stem cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19166692 2009 Usefulness of genetic polymorphisms and conventional risk factors to predict coronary heart disease in patients with familial hypercholesterolemia.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18599554 2008 Replication study of 10 genetic polymorphisms associated with coronary heart disease in a specific high-risk population with familial hypercholesterolemia.
18480432 2008 A role for E1B-AP5 in ATR signaling pathways during adenovirus infection.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17121608 2006 Comparative mapping reveals multiple rearrangements between pig chromosome 6 and human 19q13.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16690874 2006 Gene variants of VAMP8 and HNRPUL1 are associated with early-onset myocardial infarction.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15907477 2005 The interaction of the hnRNP family member E1B-AP5 with p53.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15242333 2004 Protein arginine methylation during lytic adenovirus infection.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12489984 2003 Regulation of transcription by the heterogeneous nuclear ribonucleoprotein E1B-AP5 is mediated by complex formation with the novel bromodomain-containing protein BRD7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11513728 2001 Heterogeneous nuclear ribonucleoprotein E1B-AP5 is methylated in its Arg-Gly-Gly (RGG) box and interacts with human arginine methyltransferase HRMT1L1.
11073998 2000 TAP (NXF1) belongs to a multigene family of putative RNA export factors with a conserved modular architecture.
10668806 2000 The C-terminal domain of TAP interacts with the nuclear pore complex and promotes export of specific CTE-bearing RNA substrates.
9733834 1998 E1B 55-kilodalton-associated protein: a cellular protein with RNA-binding activity implicated in nucleocytoplasmic transport of adenovirus and cellular mRNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.