Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.01
PubTator Score 10.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.026 2.9e-03
Multiple myeloma 2.026 3.9e-05
ependymoma -1.400 4.3e-02
oligodendroglioma -1.700 9.4e-03
psoriasis 1.300 3.2e-04
osteosarcoma 2.374 2.4e-07
group 3 medulloblastoma 1.300 1.7e-03
medulloblastoma, large-cell 1.300 6.8e-05
juvenile dermatomyositis 1.098 1.2e-09
Amyotrophic Lateral Sclerosis 1.126 8.6e-06
acute quadriplegic myopathy 1.574 5.8e-06
intraductal papillary-mucinous carcinoma... 1.200 4.7e-03
lung cancer 1.300 1.3e-03
breast carcinoma 1.500 3.8e-03
cystic fibrosis -1.100 1.8e-05
lung adenocarcinoma 1.318 2.0e-05
Pick disease 1.100 6.0e-05
Breast cancer -1.300 4.8e-13
ovarian cancer -1.500 1.9e-04
dermatomyositis 1.100 1.7e-03

Gene RIF (8)

PMID Text
25338097 SMN is involved in the axonal translocation of hnRNP R and hnRNP R-bound RNA/protein complexes.
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19902070 Short-term exercise resulted in a significant increase of mRNA expression of genes encoding proteins involved in the formation of precatalytic splisosome: HNRNPR.
19808671 Data demonstrate that expression levels of hnRNP A1, Q, K, R, and U influence HIV-1 production by persistently infected astrocytes, linking these hnRNPs to HIV replication.
19808671 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19581295 HNRNPR enhanced transcription from the c-fos promoter.
17672918 validated occurrence of an unusual TG 3' splice site in intron 7

AA Sequence

MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDLDERAIDALRE      1 - 70
FNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDV     71 - 140
TTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAF    141 - 210
ITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYH    211 - 280
QPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLAT    281 - 350
TVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQ    351 - 420
AARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPY    421 - 490
YGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRG    491 - 560
SRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQ    561 - 630
QWK                                                                       631 - 633
//

Text Mined References (41)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25338097 2014 Presynaptic localization of Smn and hnRNP R in axon terminals of embryonic and postnatal mouse motoneurons.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23967313 2013 Heterogeneous nuclear ribonucleoprotein R cooperates with mediator to facilitate transcription reinitiation on the c-Fos gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21515746 2011 Modulation of exosome-mediated mRNA turnover by interaction of GTP-binding protein 1 (GTPBP1) with its target mRNAs.
21269460 2011 Initial characterization of the human central proteome.
20167579 2010 The heterogeneous nuclear ribonucleoprotein-R is necessary for axonal beta-actin mRNA translocation in spinal motor neurons.
19902070 2009 Changed profile of splicing regulator genes expression in response to exercise.
19808671 2009 Identification of a heterogeneous nuclear ribonucleoprotein-recognition region in the HIV Rev protein.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19581295 2009 Heterogeneous nuclear ribonucleoprotein R enhances transcription from the naturally configured c-fos promoter in vitro.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18197392 2008 hnRNP-R regulates the PMA-induced c-fos expression in retinal cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15858414 2005 Cloning and expression of a novel isoform of heterogeneous nuclear ribonucleoprotein-R.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12183049 2002 Identification of methylated proteins by protein arginine N-methyltransferase 1, PRMT1, with a new expression cloning strategy.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11773003 2002 Specific interaction of Smn, the spinal muscular atrophy determining gene product, with hnRNP-R and gry-rbp/hnRNP-Q: a role for Smn in RNA processing in motor axons?
11574476 2001 SMN interacts with a novel family of hnRNP and spliceosomal proteins.
9421497 1998 Molecular definition of heterogeneous nuclear ribonucleoprotein R (hnRNP R) using autoimmune antibody: immunological relationship with hnRNP P.