Property Summary

NCBI Gene PubMed Count 49
PubMed Score 42.84
PubTator Score 634.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (17)

PMID Text
26332123 p54nrb and hnRNPM knockdown silences the FGF1 promoter-dependent accumulation of mRNA during myoblast differentiation.
25926642 The authors propose that cleavage of and subverting the function of hnRNPM by 3C protease is a general strategy utilized by picornaviruses to facilitate viral infection.
25684943 Results suggest that glyceraldehyde-modified hnRNPM alters gene expression in nonalcoholic fatty liver disease.
25631074 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
25496916 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
25013050 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
24968937 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
24840202 findings demonstrate a novel molecular mechanism through which tumor metastasis is endowed by the hnRNPM-mediated splicing program.
24533984 Our results provide a clue that hnRNP M is a potential therapeutic target for Spinal muscular atrophy
24474660 our data suggest that TAF15 and TLS/FUS operate within similar but not identical hnRNP M-TET protein complexes to influence the transcriptional or post-transcriptional output of a particular cell type.
24381081 The present data demonstrate that the upregulation of HnRNP M is involved in human colorectal epithelial carcinogenesis and may serve as a carcinoma biomarker for colorectal cancer.
23125841 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
22174317 Cellular biotinylated heterogeneous nuclear ribonucleoprotein M (HNRNPM) is incorporated into HIV-1 Gag virus-like particles
21398516 Mechanistic control of carcinoembryonic antigen-related cell adhesion molecule-1 (CEACAM1) splice isoforms by the heterogeneous nuclear ribonuclear proteins hnRNP L, hnRNP A1, and hnRNP M.
20467437 A central region in hnRNP-M is required for interaction with CDC5L/PLRG1.
19874820 PSF (polypyrimidine tract-binding protein-associated splicing factor) and p54(nrb), two highly related proteins involved in transcription and RNA processing, are identified as new binding partners of hnRNP M.
18790094 mitochondrial ribosomal protein S12 3'-UTR interacts specifically with TRAP1 (tumor necrosis factor receptor-associated protein1), hnRNPM4 (heterogeneous nuclear ribonucleoprotein M4), Hsp70 and Hsp60 (heat shock proteins 70 and 60), and alpha-tubulin

AA Sequence

MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKR      1 - 70
YRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGR     71 - 140
PLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMITIPPSILNNPNIPNEIIHALQAGRLGSTVFVAN    141 - 210
LDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDE    211 - 280
RALPKGDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGME    281 - 350
GPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMG    351 - 420
AGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIGSGVERMGAGM    421 - 490
GFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAGLERMGPVMDRMATGLERMGA    491 - 560
NNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPALGAGIERMGLAMGGGGGASFDRAIEMERGNF    561 - 630
GGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFE    631 - 700
SPEVAERACRMMNGMKLSGREIDVRIDRNA                                            701 - 730
//

Text Mined References (66)

PMID Year Title
26332123 2015 Promoter-Dependent Translation Controlled by p54nrb and hnRNPM during Myoblast Differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25926642 2015 Heterogeneous Nuclear Ribonucleoprotein M Facilitates Enterovirus Infection.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25684943 2015 In vitro identification of nonalcoholic fatty liver disease-related protein hnRNPM.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24840202 2014 Cell type-restricted activity of hnRNPM promotes breast cancer metastasis via regulating alternative splicing.
24533984 2014 hnRNP M facilitates exon 7 inclusion of SMN2 pre-mRNA in spinal muscular atrophy by targeting an enhancer on exon 7.
24474660 2014 Selective interactions of hnRNP M isoforms with the TET proteins TAF15 and TLS/FUS.
24381081 2014 Identification of HnRNP M as a novel biomarker for colorectal carcinoma by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21398516 2011 Mechanistic control of carcinoembryonic antigen-related cell adhesion molecule-1 (CEACAM1) splice isoforms by the heterogeneous nuclear ribonuclear proteins hnRNP L, hnRNP A1, and hnRNP M.
21269460 2011 Initial characterization of the human central proteome.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19874820 2010 hnRNP M interacts with PSF and p54(nrb) and co-localizes within defined nuclear structures.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18790094 2008 cis-acting sequences and trans-acting factors in the localization of mRNA for mitochondrial ribosomal proteins.
18726360 2000 Cloning and characterization of a novel deletion mutant of heterogeneous nuclear ribonucleoprotein M4 from human dendritic cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15175327 2004 A proteomic study of SUMO-2 target proteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14597422 2003 Surface expression of heterogeneous nuclear RNA binding protein M4 on Kupffer cell relates to its function as a carcinoembryonic antigen receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11823437 2002 The DEXD/H-box RNA helicase RHII/Gu is a co-factor for c-Jun-activated transcription.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11406629 2001 Heterogeneous RNA-binding protein M4 is a receptor for carcinoembryonic antigen in Kupffer cells.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
8692693 1996 The human hnRNP-M proteins: structure and relation with early heat shock-induced splicing arrest and chromosome mapping.
8441656 1993 The human hnRNP M proteins: identification of a methionine/arginine-rich repeat motif in ribonucleoproteins.
8088785 1994 Molecular cloning, cDNA analysis, and localization of a monomer of the N-acetylglucosamine-specific receptor of the thyroid, NAGR1, to chromosome 19p13.3-13.2.
7558047 1995 Molecular cloning, cDNA analysis, and localization of a monomer of the N-acetylglucosamine-specific receptor of the thyroid, NAGR1, to chromosome 19p13.3-13.2.