Property Summary

NCBI Gene PubMed Count 60
PubMed Score 302.68
PubTator Score 59.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.700 5.8e-03
ependymoma 1.900 8.3e-03
oligodendroglioma 1.300 1.2e-02
psoriasis 1.300 1.9e-08
osteosarcoma 1.699 2.3e-04
atypical teratoid / rhabdoid tumor -1.200 2.8e-03
glioblastoma -1.200 2.2e-04
medulloblastoma, large-cell -1.200 3.3e-03
pancreatic ductal adenocarcinoma liver m... 1.447 5.5e-04
lung cancer 1.400 6.4e-04
adult high grade glioma -1.300 9.2e-03
group 3 medulloblastoma 1.300 4.1e-02

Gene RIF (35)

PMID Text
26805816 hnRNPA2B1, hnRNPD, hnRNPL , and YBX1 might play important roles in gastric cancer tumorigenesis.
26437669 hnRNP L controls inclusion of a broad spectrum of alternative cassette exons in T cells.
26051023 The study presents the structural characterization of the RNA recognition motif domains of hnRNP-L and demonstrate their function in repressing exon 4 of SLC2A2.
25982410 Data suggest that incorporation of 3(S)-methyl-beta-alanine into a short alpha-helical region of nucleic acid binding domain of hnRNP LL significantly stabilizes helix without affecting its DNA binding properties.
25902538 hnRNP K and hnRNP L may serve as A1CF-like cofactors in AID-mediated class switch recombination and somatic hypermutation
25623890 Our results reveal that hnRNP L is a new regulator for CD44 V10 exon splicing.
25354590 HnRNP C, YB-1 and hnRNP L coordinately enhance skipping of human MUSK exon 10 to generate a Wnt-insensitive MuSK isoform.
24526010 Results show that HNRNPL represses splicing when bound to intronic regions upstream of alternative exons, and in contrast, activates splicing when bound to the downstream intron.
24371310 THRIL has a role in regulating TNFalpha expression through its interaction with hnRNPL
24164894 Data show that alternative exons with weak 5' splice site sequences specifically show a strong correlation between hnRNP L binding and hnRNP L-dependent splicing regulation.
24125732 hnRNP L is a potential biomarker for the diagnosis of HBV-HCC and show that hnRNP L contributes to HCC progression.
24121633 HnRNP L and hnRNP LL antagonistically modulate PTB-mediated splicing suppression of CHRNA1 pre-mRNA.
23646903 functional component of hnRNP LL is consistent with the fact that the full-length hnRNP LL has a greater silencing activity than hnRNP L
23396972 Induction of caspase-9b expression is due to activation of hnRNP L via phosphorylation to compete/inhibit hnRNP U association with exon 3 of Casp9 mRNA.
23394998 hnRNP L represses CD45 exon 4 by recruiting hnRNP A1 to a sequence upstream of the 5' splice site
22944692 Positional proteomics analysis identifies the cleavage of human heterogeneous nuclear ribonucleoprotein L (HNRNPL) at amino acid residues 392-393 by the HIV-1 protease
22523384 Constitutive deletion of splicing factor hnRNP L impedes early embryonic development of transgenic mice.
22245417 HnRNPL is a key factor involved in the spermatogenesis by functional proteomic studies of azoospermia patients with sertoli cell only syndrome.
21398516 Mechanistic control of carcinoembryonic antigen-related cell adhesion molecule-1 (CEACAM1) splice isoforms by the heterogeneous nuclear ribonuclear proteins hnRNP L, hnRNP A1, and hnRNP M.
21343907 Hypoxia induces translocation of nuclear hnRNP L to the cytoplasm, which markedly increases hnRNP L binding to VEGFA mRNA thereby inhibiting miRNA activity.
20237420 NSP 5a3a's novel interaction with B23 and ribonuclear protein hnRNP-L implicates NSP 5a3a in cellular processes such as ribosome biogenesis and rRNA transcription .
20122404 The binding of hnRNP L to an exon represses strong splice sites but enhances weak splice sites.
19946215 hnRNP L represses splicing by preventing 5' splice site recognition of the U1 snRNP.
19912651 identified hnRNP L as a novel Sam68-interacting protein partner.
19464723 confirm the interactions of eEF1A1, p54(nrb), hnRNP-L, GAPDH and ASF/SF2 with the right terminal stem-loop domain of HDV genomic RNA in vitro
19332550 Identification of a novel, higher eukaryotic specific subunit, heterogeneous nuclear ribonucleoprotein L (HnRNP-L)required for lysine methylation in vivo.
19298794 CA repeats in the 3'UTR of bcl-2 mRNA interact with hnRNP L in vitro and in vivo; this physical association is partially involved in the decay of bcl-2 mRNA.
19124611 hnRNP L cross-regulates inclusion of an analogous poison exon in the hnRNP L-like pre-mRNA, which explains the reciprocal expression of the two closely related hnRNP L proteins.
19061868 These results strongly demonstrate the functional requirement of cellular hnRNP L for the HCV internal ribosome entry site activity.
19017650 hnRNP L is an essential component of CaMKIV-regulated alternative splicing through CA repeats, with its phosphorylation likely playing a critical role.
18202450 This study determined that hnRNP L interacts specifically with the hnRNP D/AUF1 in the yeast two-hybrid system.
18073345 11 target genes of hnRNP L were describes.
16024770 hnRNP L plays roles in enhancing stability, polyadenylation, and nucleocytoplasmic export; it does so by directly recruiting to intronless pre-mRNA processing enhancer (PPE) element-containing RNAs cofactors normally recruited to intron-containing RNAs.
12447348 HnRNP L may be involved in the regulation of many other genes containing CA repeats or A/C-rich enhancers.
11809897 AP-endonuclease 1 and hnRNP-L interact with a nCaRE-like repressor element in the AP-endonuclease 1 promoter

AA Sequence

MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQH      1 - 70
GGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQA     71 - 140
LVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDV    141 - 210
LYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQ    211 - 280
DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVG    281 - 350
GHRRGPSRYGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPG    351 - 420
AAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQ    421 - 490
AAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLG    491 - 560
FLNHYQMKNPNGPYPYTLKLCFSTAQHAS                                             561 - 589
//

Text Mined References (76)

PMID Year Title
26805816 2016 Unraveling Molecular Differences of Gastric Cancer by Label-Free Quantitative Proteomics Analysis.
26437669 2015 Global analysis of physical and functional RNA targets of hnRNP L reveals distinct sequence and epigenetic features of repressed and enhanced exons.
26051023 2015 The Signature of the Five-Stranded vRRM Fold Defined by Functional, Structural and Computational Analysis of the hnRNP L Protein.
25982410 2015 Protein Synthesis with Ribosomes Selected for the Incorporation of ?-Amino Acids.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902538 2015 Identification of DNA cleavage- and recombination-specific hnRNP cofactors for activation-induced cytidine deaminase.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25623890 2015 hnRNP L inhibits CD44 V10 exon splicing through interacting with its upstream intron.
25354590 2014 HnRNP C, YB-1 and hnRNP L coordinately enhance skipping of human MUSK exon 10 to generate a Wnt-insensitive MuSK isoform.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24526010 2014 Crosslinking-immunoprecipitation (iCLIP) analysis reveals global regulatory roles of hnRNP L.
24371310 2014 The long noncoding RNA THRIL regulates TNF? expression through its interaction with hnRNPL.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24164894 2014 Transcriptome-wide RNA interaction profiling reveals physical and functional targets of hnRNP L in human T cells.
24125732 2013 Autoantibody recognition of an N-terminal epitope of hnRNP L marks the risk for developing HBV-related hepatocellular carcinoma.
24121633 2013 HnRNP L and hnRNP LL antagonistically modulate PTB-mediated splicing suppression of CHRNA1 pre-mRNA.
23782695 2013 Crystal structures and RNA-binding properties of the RNA recognition motifs of heterogeneous nuclear ribonucleoprotein L: insights into its roles in alternative splicing regulation.
23646903 2013 Minimal functional domains of paralogues hnRNP L and hnRNP LL exhibit mechanistic differences in exonic splicing repression.
23396972 2013 hnRNP U enhances caspase-9 splicing and is modulated by AKT-dependent phosphorylation of hnRNP L.
23394998 2013 hnRNP L and hnRNP A1 induce extended U1 snRNA interactions with an exon to repress spliceosome assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22570490 2012 A conserved serine of heterogeneous nuclear ribonucleoprotein L (hnRNP L) mediates depolarization-regulated alternative splicing of potassium channels.
22523384 2012 Alternative splicing controlled by heterogeneous nuclear ribonucleoprotein L regulates development, proliferation, and migration of thymic pre-T cells.
22245417 2012 HnRNPL as a key factor in spermatogenesis: Lesson from functional proteomic studies of azoospermia patients with sertoli cell only syndrome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21398516 2011 Mechanistic control of carcinoembryonic antigen-related cell adhesion molecule-1 (CEACAM1) splice isoforms by the heterogeneous nuclear ribonuclear proteins hnRNP L, hnRNP A1, and hnRNP M.
21343907 2011 Repression of VEGFA by CA-rich element-binding microRNAs is modulated by hnRNP L.
21269460 2011 Initial characterization of the human central proteome.
20237420 2010 NSP 5a3a's link to nuclear-cyto proteins B23 and hnRNP-L between normal and aberrant breast cell lines.
20122404 2010 Context-dependent regulatory mechanism of the splicing factor hnRNP L.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19946215 HnRNP L-mediated regulation of mammalian alternative splicing by interference with splice site recognition.
19912651 2009 Proteomic identification of heterogeneous nuclear ribonucleoprotein L as a novel component of SLM/Sam68 Nuclear Bodies.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19464723 2009 The hepatitis delta virus RNA genome interacts with eEF1A1, p54(nrb), hnRNP-L, GAPDH and ASF/SF2.
19332550 2009 Heterogeneous nuclear ribonucleoprotein L Is a subunit of human KMT3a/Set2 complex required for H3 Lys-36 trimethylation activity in vivo.
19298794 2009 hnRNP L binds to CA repeats in the 3'UTR of bcl-2 mRNA.
19124611 2009 Auto- and cross-regulation of the hnRNP L proteins by alternative splicing.
19061868 2009 hnRNP L is required for the translation mediated by HCV IRES.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19017650 2009 The heterogeneous nuclear ribonucleoprotein L is an essential component in the Ca2+/calmodulin-dependent protein kinase IV-regulated alternative splicing through cytidine-adenosine repeats.
18669861 2008 Regulation of CD45 alternative splicing by heterogeneous ribonucleoprotein, hnRNPLL.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18202450 2007 Heterogeneous nuclear ribonucleoprotein D/AUF1 interacts with heterogeneous nuclear ribonucleoprotein L.
18161049 2008 Natural antisense transcript stabilizes inducible nitric oxide synthase messenger RNA in rat hepatocytes.
18073345 2008 Diverse roles of hnRNP L in mammalian mRNA processing: a combined microarray and RNAi analysis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
16024770 2005 Binding of hnRNP L to the pre-mRNA processing enhancer of the herpes simplex virus thymidine kinase gene enhances both polyadenylation and nucleocytoplasmic export of intronless mRNAs.
15798186 2005 A novel SR-related protein is required for the second step of Pre-mRNA splicing.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14528909 2003 Decreased brain levels of Lupus La protein and increased U5 small ribonucleoprotein-specific 40 kDa protein in fetal Down syndrome.
12869704 2003 Novel functional role of CA repeats and hnRNP L in RNA stability.
12576095 2003 PLG regulates hnRNP-L expression in the rat striatum and pre-frontal cortex: identification by ddPCR.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447348 2003 HnRNP L stimulates splicing of the eNOS gene by binding to variable-length CA repeats.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12130696 2002 Inflammation modulates the interaction of heterogeneous nuclear ribonucleoprotein (hnRNP) I/polypyrimidine tract binding protein and hnRNP L with the 3'untranslated region of the murine inducible nitric-oxide synthase mRNA.
11809897 2002 Human AP-endonuclease 1 and hnRNP-L interact with a nCaRE-like repressor element in the AP-endonuclease 1 promoter.
11280764 2001 Molecular basis of T cell-mediated recognition of pancreatic cancer cells.
10772858 2000 Protein-protein interaction among hnRNPs shuttling between nucleus and cytoplasm.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10441480 1999 hnRNP A2 and hnRNP L bind the 3'UTR of glucose transporter 1 mRNA and exist as a complex in vivo.
9880507 1999 Regulation of human vascular endothelial growth factor mRNA stability in hypoxia by heterogeneous nuclear ribonucleoprotein L.
9563502 1998 Polypyrimidine tract-binding protein interacts with HnRNP L.
8871564 1996 The mouse poly(C)-binding protein exists in multiple isoforms and interacts with several RNA-binding proteins.
2687284 1989 A novel heterogeneous nuclear RNP protein with a unique distribution on nascent transcripts.
2576798 1989 The ribonucleoprotein structures along the pathway of mRNA formation.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.