Property Summary

NCBI Gene PubMed Count 161
PubMed Score 270.48
PubTator Score 212.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.926 1.8e-04
psoriasis -1.100 4.2e-04
osteosarcoma -1.246 1.0e-05
acute quadriplegic myopathy 1.099 6.1e-04
Subcutaneous panniculitis-like T-cell ly... 1.600 2.9e-02
ovarian cancer -1.800 1.6e-06

 OMIM Phenotype (1)

Gene RIF (99)

PMID Text
26713736 hnRNP K may be a key molecule involved in cell motility in RCC cells
26586566 It describes the identification of heterogeneous nuclear ribonucleoprotein K (hnRNPK) as one of the composite element binding factors(CEBF) that acts as transactivator of PXR promoter.
26530384 The authors identified two new human proteins that interact with Ehrlichia chaffeensis EtpE-C: CD147 and heterogeneous nuclear ribonucleoprotein K (hnRNP-K).
26412324 Data implicate hnRNPK in the development of hematological disorders and suggest hnRNPK acts as a tumor suppressor.
26330540 hnRNP K binds miR-122, a mature liver-specific microRNA required for Hepatitis C virus replication.
26317903 Data show that proto-oncogene protein c-myc is upregulated by sumoylated heterogeneous nuclear ribonucleoprotein K (hnRNP K) at the translational level in Burkitt's lymphoma cells.
26305187 RTVP-1 regulates glioma cell spreading, migration and invasion and that these effects are mediated via interaction with N-WASP and by interfering with the inhibitory effect of hnRNPK on the function of this protein.
26164948 hnRNP K interacts with EV71 5' UTR, which is required for efficient synthesis of viral RNA.[review]
26136337 we investigate the role of hnRNP K in the radioresistance of malignant melanoma cells
25865411 These results indicate that dengue virus type 2 and Junin virus induce hnRNP K cytoplasmic translocation to favor viral multiplication.
25713416 These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis
25701787 hnRNP K plays an important role in the mitotic process in colon cancer cells.hnRNP K upregulates NUF2 and promotes the tumorigenicity of colon cancer cells.
25569684 HNRNPK might determine efficiency of Hepatitis C virus particle production by limiting the availability of viral RNA for incorporation into virions.
25497182 Data indicate that twenty proteins were identified as binding partners of the primary activating element in the heterogeneous nuclear ribonucleoprotein K (hnRNP K) promoter.
25410660 Inhibition of CDK2 phosphorylation blocked phosphorylation of hnRNP K, preventing its incorporation into stress granules (SGs). Due to interaction between hnRNP K with TDP-43, the loss of hnRNP K from SGs prevented accumulation of TDP-43.
25281771 hnRNPK is potentially implicated in the radiogenic response of HNSCC.
25005557 hnRNP K and PU.1 act synergistically during granulocytic differentiation, hnRNP K seems to have a negative effect on PU.1 activity during monocytic maturation
24885469 HnRNP K can induce MMP12 expression and enzyme activity through activating MMP12 promoter, which promotes cell migration and invasion in nasopharyngeal carcinoma cells.
24626777 Results indicate that the interaction between the AR and hnRNP K has an important role in the progression of prostate cancer.
24594223 CNBP overexpression caused increase of cell death and suppression of cell metastasis through its induction of G-quadruplex formation in the promoter of hnRNP K resulting in hnRNP K down-regulation
24508256 Data show that SET accumulation up-regulated hnRNPK mRNA and total/phosphorylated protein, promoted hnRNPK nuclear location, and reduced Bcl-x mRNA levels.
23857582 hnRNPK may play a role in recruitment of XRN2 to gene loci thus regulating coupling 3'-end pre-mRNA processing to transcription termination.
23843646 These studies demonstrate hnRNP K to be a multifunctional protein that supports vesicular stomatitis virus infection via its role(s) in suppressing apoptosis of infected cells.
23825951 NS1-BP-hnRNPK complex is a key mediator of influenza A virus gene expression.
23798440 heterogeneous nuclear ribonucleoprotein K (hnRNPK), a protein known to integrate multiple signal transduction pathways with gene expression, as a SERT distal polyadenylation element binding protein
23564449 hnRNP-K regulates extracellular matrix, cell motility, and angiogenesis pathways. Involvement of the selected genes (Cck, Mmp-3, Ptgs2, and Ctgf) and pathways was validated by gene-specific expression analysis
23519117 Caspase-3 cleaves hnRNP K in erythroid differentiation.
23455382 Prolonged downregulation of hnRNP K using small interfering RNA significantly decreased cell viability and increased apoptosis in HCC cell lines in a p53-independent manner.
23343766 ATM-dependent phosphorylation of heterogeneous nuclear ribonucleoprotein K promotes p53 transcriptional activation in response to DNA damage.
23317503 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein K (HNRNPK, TUNP), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein K (HNRNPK, TUNP), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23099853 HnRNP K controlled expression of IE2 protein of Human cytomegalovirus during viral replication.
23092970 SUMO modification plays a crucial role in the control of hnRNP-K's function as a p53 co-activator in response to DNA damage by UV
22960638 HNRNPK affects production of the essential NEAT1_2 isoform by negatively regulating its 3'-end polyadenylation by arresting CFIm complex binding near NEAT1_1's alternative polyadenylation site.
22879910 hnRNP K, when co-expressed with EBNA2, strongly enhances viral latent membrane protein 2A (LMP2A) expression.
22825850 DNA damage-induced Pc2 activation to the p53 transcriptional co-activation through hnRNP K sumoylation.
22760167 Overexpression of hnRNP K is associated with early hepatocellular carcinoma in patients with cirrhosis.
22582387 hnRNP K is indispensable for tumor cell viability and targeting of hnRNP K by granzymes contributes to or reinforces the cell death mechanisms by which cytotoxic lymphocytes eliminate tumor cells.
22335908 Helicobacter pylori L-form may be associated with up-regulated hnRNPK expression in gastric carcinoma.
22321252 Elevated cytoplasmic hnRNP K and TP overexpression are associated with poorer survival in oral squamous cell carcinoma patients
21821029 Via phosphorylating hnRNPK Aurora-A participates in regulating p53 activity during DNA damage.
21466159 Heterogeneous nuclear ribonucleoprotein K and nucleolin transcriptionally activate the vascular endothelial growth factor promoter through interaction with secondary DNA structures
21321982 role of hnRNP K in prostate carcinoma might be played by the interaction with the androgen receptor.
21233203 a model where Pol II transcription-driven recruitment of hnRNP K along the EGR-1 locus compartmentalizes activation of the ERK cascade at these genes, events that regulate synthesis of mature mRNA.
21184736 these results identify preferred PRMT1 methylation sequences of hnRNP K by direct methylation assay and implicate a role of arginine methylation in regulating intracellular distribution of hnRNP K.
20888333 Results indicate that hnRNP K has an impact on a late step of herpesviral propagation making it a potential antiviral target.
20623123 Data show that The level of expression of hnRNP K was greater in several myeloid leukemia cell lines such as HL-60, OUN-1, UT-7, and K562 than in PBMCs from healthy individuals.
20548952 suggested that expanded AUUCU repeats within the spliced intronic sequence strongly bind to hnRNP K.
20499280 Higher expression of the heterogeneous nuclear ribonucleoprotein k is associated with melanoma.
20408130 Two human colorectal cancer cell lines of different metastatic potential.Expression of heterogeneous nuclear ribonucleoprotein K (hnRNP K) in LoVo cells was higher than in SW480 cells.
20371611 heterogeneous nuclear ribonucleoprotein K is a transactivator for human low density lipoprotein receptor gene transcription
20224598 FLIP expression is transcriptionally regulated by hnRNP K and nucleolin, and may be a potential prognostic and therapeutic marker for nasopharyngeal carcinoma.
19880579 hnRNP-K was identiied as one of the ERK targets essential for IL-2 production and shown to be required for T cell late activation.
19808671 Data demonstrate that expression levels of hnRNP A1, Q, K, R, and U influence HIV-1 production by persistently infected astrocytes, linking these hnRNPs to HIV replication.
19808671 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein K (HNRNPK, TUNP), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19747914 proteolytically activated PKC-delta down-regulates hnRNP K protein in a proteasome-dependent manner, which plays an important role in apoptosis induction
19653139 The overexpression of hnRNPK, which is regulated by BCR-ABL and Ras-MAPK signaling pathways, may promote the progression of CML.
19609950 Data unveiled an important new signaling pathway that linked by hnRNP K and mutant p53 in pancreatic cancer tumorigenesis.
19548310 Cytoplasmic hnRNP K increased significantly from leukoplakia to head-and-neck/oral squamous cell carcinomas.
19520842 hnRNP K has a role in preventing the production of the pro-apoptotic Bcl-x(S) splice isoform
19401687 hnRNP K has potential implications at the diagnostic, prognostic and therapeutic levels in prostate cancer.
19330019 Results collectively establish the regulation and role of ERK-mediated cytoplasmic accumulation of hnRNP K as an upstream modulator of TP, suggesting that hnRNP K may be an attractive candidate as a future therapeutic target for cancer.
19258514 Translational inhibition of AR by hnRNP-K may occur in organ-confined tumors but possibly at a reduced level in metastases. HnRNP-K is the first protein identified that directly interacts with and regulates the AR translational apparatus.
19249676 MDM2 released from p53 by RITA promotes degradation of p21 and the p53 cofactor hnRNP K, required for p21 transcription
19170760 hnRNP K and RBM42 have a role in the maintenance of cellular ATP level in the stress conditions possibly through protecting their target mRNAs.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19101556 The data here provide possible mechanisms of how the non-enzymatic activity of PRMT family protein associates with hnRNP K protein and regulates hnRNP K protein-involved transactivation functions.
19015635 Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells.
18854308 HNRNP K and microRNA-16 have roles in cyclooxygenase-2 RNA stability induced by S100b, a ligand of the receptor for advanced glycation end products
18854243 The interaction of hnRNP-K with Nef strongly increased HIV transcription, which depended on Tat and the NF-kB motif in the viral promoter, but not on NF-kB activation.
18854243 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein K (HNRNPK, TUNP), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18559600 Cytoplasmic hnRNP K and high thymidine phosphorylase may be potential prognostic and therapeutic markers for nasopharyngeal carcinoma.
18472002 Inhibition of methylation in hnRNP K attenuated the recruitment of p53 to p21 promoter, and reduced p53 transcriptional activity.
18441016 hnRNP K binds to the 3'-untranslated region of the c-Src mRNA and inhibits its translation by blocking 80 S ribosome formation
17672864 APOBEC3 suppresses HBV replication in hepatocytes by inhibiting hnRNP K-mediated transcription and expression of HBV genes as well as HBV core DNA synthesis.
17667925 Heterogeneous nuclear ribonucleoprotein K overexpression in oral squamous cell carcinoma.
17561226 interacts with Sindbis virus NSP2 and viral subgenomic mRNA
17483488 Isolation of antibodies from cells with loss of migration phenotype and identification of their target proteins revealed the involvement of the heterogeneous nuclear ribonucleoprotein K (hnRNP-K), a multifunctional signaling protein, in metastasis
17191129 Tandem mass-spectrometric analysis of the peptide at residues 288-303 of heterogeneous nuclear ribonucleoprotein K (hnRNP K) shows that both Arg296 and Arg299 are dimethylated.
16564677 These findings provide a putative mechanism by which transcriptional activity of hnRNP K can be discretely controlled through the regulation of PP1 activity.
16496041 satellite I RNA binds to hnRNP K protein
16492668 arginine dimethylation of heterogeneous nuclear ribonucleoprotein K by protein-arginine methyltransferase 1 inhibits its interaction with c-Src
16404425 Alternative isoform of hnRNPK found in colonic tumor and surrounding mucosa; is first example of RNA editing even in cancer and its surrounding tissue
16360036 hnRNP K is a HDM2 target and serves as a cofactor for p53. HnRNP K plays key roles in coordinating transcriptional responses to DNA damage.
16293596 HNRPK down-regulation and interference with HNRPK translation-but not transcription-regulatory activity impairs proliferation, clonogenic potential, and leukemogenic activity of BCR/ABL-expressing myeloid 32Dcl3 and/or primary CD34+ CML-BC cells
16004877 NMR and X-ray crystallographic studies of the third KH domain of hnRNP K in complex with single-stranded nucleic acids
15860232 hnRNP K is involved in B cell receptor signalling pathway
15671036 the mutually antagonistic action of two RNA-binding proteins, Hu and hnRNP K, control the timing of the switch from proliferation to neuronal differentiation through the post-transcriptional regulation of p21 mRNA
15514164 hnRNP K is a positive effector of collagen synthesis acting at the post-transcriptional level by interaction with the 3'-untranslated regions (3'-UTRs) of COL1A1, 1A2, and 3A1 mRNAs.
15486205 ORF57 and hnRNP K interaction may modulate ORF57-mediated regulation of viral gene expression
15039586 Co-crystallization of the third KH domain of human hnRNP K with a 15-mer ssDNA showed that the crystals contained the complex containing three KH3 domains per 15-mer ssDNA
14562022 Nuclear shift of hnRNP K protein in dividing cells may reflect its involvement in signalling multiple events that regulate expression of genes in proliferating cells
12411317 acts together with Pur(alpha) to repress the transcriptional activity of the CD43 gene promoter during lymphocyte activation
12370808 we describe the identification of heterogeneous nuclear ribonucleoprotein K (hnRNP K) as a protein that specifically interacts with Sam68 in vitro and in vivo.
12370808 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein K (HNRNPK, TUNP), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12183465 examination into mechanisms of hnRNP K activities by identifying protein factors that interact with it
12093748 hnRNP K KH3 specifically recognizes a tetrad of sequence 5'd-TCCC. The complex is stabilized by a dense network of methyl-oxygen hydrogen bonds involving the methyl groups of 3 isoleucine residues and the O2 and N3 atoms of the 2 central cytosine bases.
12052863 c-Src-mediated phosphorylation of hnRNP K drives translational activation of specifically silenced mRNAs(hnRNPK)
11867641 Heterogeneous nuclear ribonucleoprotein (hnRNP) K is a component of an intronic splicing enhancer complex that activates the splicing of the alternative exon 6A from chicken beta-tropomyosin pre-mRNA.

AA Sequence

METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRT      1 - 70
DYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKG     71 - 140
SDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIIL    141 - 210
DLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDY    211 - 280
DDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID    281 - 350
TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS    351 - 420
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF                               421 - 463
//

Text Mined References (183)

PMID Year Title
26713736 2015 Cytoplasmic Accumulation of Heterogeneous Nuclear Ribonucleoprotein K Strongly Promotes Tumor Invasion in Renal Cell Carcinoma Cells.
26586566 2015 Identification and interplay of sequence specific DNA binding proteins involved in regulation of human Pregnane and Xenobiotic Receptor gene.
26530384 2015 EtpE Binding to DNase X Induces Ehrlichial Entry via CD147 and hnRNP-K Recruitment, Followed by Mobilization of N-WASP and Actin.
26412324 2015 hnRNP K Is a Haploinsufficient Tumor Suppressor that Regulates Proliferation and Differentiation Programs in Hematologic Malignancies.
26330540 2015 Heterogeneous Ribonucleoprotein K (hnRNP K) Binds miR-122, a Mature Liver-Specific MicroRNA Required for Hepatitis C Virus Replication.
26317903 2015 Bortezomib inhibits Burkitt's lymphoma cell proliferation by downregulating sumoylated hnRNP K and c-Myc expression.
26305187 2015 RTVP-1 regulates glioma cell migration and invasion via interaction with N-WASP and hnRNPK.
26173930 2015 GeneMatcher aids in the identification of a new malformation syndrome with intellectual disability, unique facial dysmorphisms, and skeletal and connective tissue abnormalities caused by de novo variants in HNRNPK.
26164948 2015 [Molecular Mechanism of Action of hnRNP K and RTN3 in the Replication of Enterovirus 71].
26136337 2015 Radiosensitization and downregulation of heterogeneous nuclear ribonucleoprotein K (hnRNP K) upon inhibition of mitogen/extracellular signal-regulated kinase (MEK) in malignant melanoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25865411 2015 The heterogeneous nuclear ribonucleoprotein K (hnRNP K) is a host factor required for dengue virus and Junín virus multiplication.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25713416 2015 Regulation of C-X-C chemokine gene expression by keratin 17 and hnRNP K in skin tumor keratinocytes.
25701787 2015 Heterogeneous nuclear ribonucleoprotein K upregulates the kinetochore complex component NUF2 and promotes the tumorigenicity of colon cancer cells.
25569684 2015 Identification of HNRNPK as regulator of hepatitis C virus particle production.
25497182 2015 Transcriptional regulation of heterogeneous nuclear ribonucleoprotein K gene expression.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25410660 2015 Phosphorylation of hnRNP K by cyclin-dependent kinase 2 controls cytosolic accumulation of TDP-43.
25281771 2015 Proteomic identification of the heterogeneous nuclear ribonucleoprotein K as irradiation responsive protein related to migration.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25005557 2014 hnRNP K in PU.1-containing complexes recruited at the CD11b promoter: a distinct role in modulating granulocytic and monocytic differentiation of AML-derived cells.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24885469 2014 Matrix metalloproteinase 12 is induced by heterogeneous nuclear ribonucleoprotein K and promotes migration and invasion in nasopharyngeal carcinoma.
24626777 2014 Prostate cancer: prognostic significance of the association of heterogeneous nuclear ribonucleoprotein K and androgen receptor expression.
24594223 2014 Cellular nucleic acid binding protein suppresses tumor cell metastasis and induces tumor cell death by downregulating heterogeneous ribonucleoprotein K in fibrosarcoma cells.
24508256 2014 Accumulated SET protein up-regulates and interacts with hnRNPK, increasing its binding to nucleic acids, the Bcl-xS repression, and cellular proliferation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23974796 2013 Identification of a long non-coding RNA-associated RNP complex regulating metastasis at the translational step.
23857582 2013 Heterogeneous nuclear ribonucleoprotein (HnRNP) K genome-wide binding survey reveals its role in regulating 3'-end RNA processing and transcription termination at the early growth response 1 (EGR1) gene through XRN2 exonuclease.
23843646 2013 Heterogeneous nuclear ribonucleoprotein K supports vesicular stomatitis virus replication by regulating cell survival and cellular gene expression.
23825951 2013 Cellular RNA binding proteins NS1-BP and hnRNP K regulate influenza A virus RNA splicing.
23798440 2013 Anxiety-associated alternative polyadenylation of the serotonin transporter mRNA confers translational regulation by hnRNPK.
23564449 2013 Heterogeneous nuclear ribonucleoprotein K (hnRNP-K) promotes tumor metastasis by induction of genes involved in extracellular matrix, cell movement, and angiogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23519117 2013 Caspase-3 cleaves hnRNP K in erythroid differentiation.
23455382 2013 hnRNP K suppresses apoptosis independent of p53 status by maintaining high levels of endogenous caspase inhibitors.
23343766 2013 ATM-dependent phosphorylation of heterogeneous nuclear ribonucleoprotein K promotes p53 transcriptional activation in response to DNA damage.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23099853 2013 Granzyme M targets host cell hnRNP K that is essential for human cytomegalovirus replication.
23092970 2012 SUMOylation of hnRNP-K is required for p53-mediated cell-cycle arrest in response to DNA damage.
22967762 2012 Characterization of O-GlcNAc cycling and proteomic identification of differentially O-GlcNAcylated proteins during G1/S transition.
22960638 2012 Alternative 3'-end processing of long noncoding RNA initiates construction of nuclear paraspeckles.
22879910 2012 Binding of the heterogeneous ribonucleoprotein K (hnRNP K) to the Epstein-Barr virus nuclear antigen 2 (EBNA2) enhances viral LMP2A expression.
22825850 2012 DNA damage-induced heterogeneous nuclear ribonucleoprotein K sumoylation regulates p53 transcriptional activation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22760167 2012 Heterogeneous nuclear ribonucleoprotein K (hnRNP K) is a tissue biomarker for detection of early hepatocellular carcinoma in patients with cirrhosis.
22721921 Proteomic analysis of podosome fractions from macrophages reveals similarities to spreading initiation centres.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22582387 2012 All human granzymes target hnRNP K that is essential for tumor cell viability.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22335908 2011 [Expression of hnRNPK in gastric carcinoma and its relationship with Helicobacter pylori L-form infection].
22321252 2012 Heterogeneous ribonucleoprotein K and thymidine phosphorylase are independent prognostic and therapeutic markers for oral squamous cell carcinoma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21821029 2011 Aurora-A phosphorylates hnRNPK and disrupts its interaction with p53.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21466159 2011 Heterogeneous nuclear ribonucleoprotein K and nucleolin as transcriptional activators of the vascular endothelial growth factor promoter through interaction with secondary DNA structures.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21321982 2011 Androgen receptor and heterogeneous nuclear ribonucleoprotein K colocalize in the nucleoplasm and are modulated by bicalutamide and 4-hydroxy-tamoxifen in prostatic cancer cell lines.
21269460 2011 Initial characterization of the human central proteome.
21233203 2011 Direct recruitment of ERK cascade components to inducible genes is regulated by heterogeneous nuclear ribonucleoprotein (hnRNP) K.
21184736 2011 Identification of the methylation preference region in heterogeneous nuclear ribonucleoprotein K by protein arginine methyltransferase 1 and its implication in regulating nuclear/cytoplasmic distribution.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20888333 2010 The heterogeneous nuclear ribonucleoprotein K is important for Herpes simplex virus-1 propagation.
20673990 2010 A large intergenic noncoding RNA induced by p53 mediates global gene repression in the p53 response.
20623123 2010 Autoantibodies specific to hnRNP K: a new diagnostic marker for immune pathophysiology in aplastic anemia.
20548952 2010 Inactivation of hnRNP K by expanded intronic AUUCU repeat induces apoptosis via translocation of PKCdelta to mitochondria in spinocerebellar ataxia 10.
20499280 2010 Higher expression of the heterogeneous nuclear ribonucleoprotein k in melanoma.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20408130 2010 HnRNP K and PDI marked response to chemotherapy to human colorectal cancer cells.
20371611 2010 Identification of heterogeneous nuclear ribonucleoprotein K as a transactivator for human low density lipoprotein receptor gene transcription.
20224598 2010 The antiapoptotic protein, FLIP, is regulated by heterogeneous nuclear ribonucleoprotein K and correlates with poor overall survival of nasopharyngeal carcinoma patients.
20085233 2010 Identification of DeltaNp63alpha protein interactions by mass spectrometry.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19880579 2009 hnRNP-K is a nuclear target of TCR-activated ERK and required for T-cell late activation.
19808671 2009 Identification of a heterogeneous nuclear ribonucleoprotein-recognition region in the HIV Rev protein.
19747914 2009 Protein kinase C-delta mediates down-regulation of heterogeneous nuclear ribonucleoprotein K protein: involvement in apoptosis induction.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19653139 2010 The role of heterogeneous nuclear ribonucleoprotein K in the progression of chronic myeloid leukemia.
19609950 2010 Increased expression of the heterogeneous nuclear ribonucleoprotein K in pancreatic cancer and its association with the mutant p53.
19548310 2009 Heterogeneous ribonucleoprotein K is a marker of oral leukoplakia and correlates with poor prognosis of squamous cell carcinoma.
19520842 2009 Heterogeneous nuclear ribonucleoprotein K represses the production of pro-apoptotic Bcl-xS splice isoform.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401687 2009 Heterogeneous nuclear ribonucleoprotein K: altered pattern of expression associated with diagnosis and prognosis of prostate cancer.
19330019 2009 Thymidine phosphorylase mRNA stability and protein levels are increased through ERK-mediated cytoplasmic accumulation of hnRNP K in nasopharyngeal carcinoma cells.
19258514 2009 Heterogeneous nuclear ribonucleoprotein K is a novel regulator of androgen receptor translation.
19249676 2009 MDM2-dependent downregulation of p21 and hnRNP K provides a switch between apoptosis and growth arrest induced by pharmacologically activated p53.
19174163 2009 Proteomic and genomic analysis of PITX2 interacting and regulating networks.
19170760 2009 hnRNP K interacts with RNA binding motif protein 42 and functions in the maintenance of cellular ATP level during stress conditions.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19101556 2009 Physical and functional interactions between hnRNP K and PRMT family proteins.
19015635 2009 Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells.
18854308 2008 Distinct roles of heterogeneous nuclear ribonuclear protein K and microRNA-16 in cyclooxygenase-2 RNA stability induced by S100b, a ligand of the receptor for advanced glycation end products.
18854243 2008 HIV Nef enhances Tat-mediated viral transcription through a hnRNP-K-nucleated signaling complex.
18775702 2008 African swine fever virus protein p30 interaction with heterogeneous nuclear ribonucleoprotein K (hnRNP-K) during infection.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559600 2008 Heterogeneous ribonucleoprotein k and thymidine phosphorylase are independent prognostic and therapeutic markers for nasopharyngeal carcinoma.
18472002 2008 Arginine methylation of hnRNP K enhances p53 transcriptional activity.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
18441016 2008 mRNA silencing in human erythroid cell maturation: heterogeneous nuclear ribonucleoprotein K controls the expression of its regulator c-Src.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17672864 2008 Cytidine deaminase APOBEC3B interacts with heterogeneous nuclear ribonucleoprotein K and suppresses hepatitis B virus expression.
17667925 2007 Evidence for heterogeneous nuclear ribonucleoprotein K overexpression in oral squamous cell carcinoma.
17561226 2007 Heterogeneous nuclear ribonuclear protein K interacts with Sindbis virus nonstructural proteins and viral subgenomic mRNA.
17483488 2007 Loss-of-function screening by randomized intracellular antibodies: identification of hnRNP-K as a potential target for metastasis.
17191129 2007 Direct mass-spectrometric identification of Arg296 and Arg299 as the methylation sites of hnRNP K protein for methyltransferase PRMT1.
17178840 2007 Deciphering the cross talk between hnRNP K and c-Src: the c-Src activation domain in hnRNP K is distinct from a second interaction site.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16564677 2006 PITK, a PP1 targeting subunit that modulates the phosphorylation of the transcriptional regulator hnRNP K.
16496041 2006 Mitochondria-associated satellite I RNA binds to hnRNP K protein.
16492668 2006 Asymmetric arginine dimethylation of heterogeneous nuclear ribonucleoprotein K by protein-arginine methyltransferase 1 inhibits its interaction with c-Src.
16404425 2006 Editing of hnRNP K protein mRNA in colorectal adenocarcinoma and surrounding mucosa.
16360036 2005 hnRNP K: an HDM2 target and transcriptional coactivator of p53 in response to DNA damage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16293596 2006 A MAPK/HNRPK pathway controls BCR/ABL oncogenic potential by regulating MYC mRNA translation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16004877 2005 X-ray crystallographic and NMR studies of the third KH domain of hnRNP K in complex with single-stranded nucleic acids.
15860232 2005 Anti-IgM induces up-regulation and tyrosine-phosphorylation of heterogeneous nuclear ribonucleoprotein K proteins (hnRNP K) in a Ramos B cell line.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15671036 2005 Involvement of Hu and heterogeneous nuclear ribonucleoprotein K in neuronal differentiation through p21 mRNA post-transcriptional regulation.
15635413 2005 Nucleolar proteome dynamics.
15514164 2004 RNA-binding proteins heterogeneous nuclear ribonucleoprotein A1, E1, and K are involved in post-transcriptional control of collagen I and III synthesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486205 2004 Protein kinase CK2 phosphorylation regulates the interaction of Kaposi's sarcoma-associated herpesvirus regulatory protein ORF57 with its multifunctional partner hnRNP K.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15170860 2004 hnRNP K: one protein multiple processes.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15039586 2004 Crystallization, microPIXE and preliminary crystallographic analysis of the complex between the third KH domain of hnRNP K and single-stranded DNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14562022 2003 Nuclear shift of hnRNP K protein in neoplasms and other states of enhanced cell proliferation.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12951515 2003 Heterogeneous nuclear ribonucleoprotein K interacts with and is proteolyzed by calpain in vivo.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12529443 2003 Sam68 RNA binding protein is an in vivo substrate for protein arginine N-methyltransferase 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411317 2002 hnRNP-K and Pur(alpha) act together to repress the transcriptional activity of the CD43 gene promoter.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12370808 2002 Functional interaction of Sam68 and heterogeneous nuclear ribonucleoprotein K.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12183465 2002 An RNA helicase, DDX1, interacting with poly(A) RNA and heterogeneous nuclear ribonucleoprotein K.
12093748 2002 Molecular basis of sequence-specific single-stranded DNA recognition by KH domains: solution structure of a complex between hnRNP K KH3 and single-stranded DNA.
12052863 2002 c-Src-mediated phosphorylation of hnRNP K drives translational activation of specifically silenced mRNAs.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11741984 2002 Heterogeneous nuclear ribonucleoprotein K protein associates with multiple mitochondrial transcripts within the organelle.
11557983 2001 The SH2/SH3 adaptor Grb4 transduces B-ephrin reverse signals.
11259409 2001 Identification of new JNK substrate using ATP pocket mutant JNK and a corresponding ATP analogue.
11231586 2001 ERK phosphorylation drives cytoplasmic accumulation of hnRNP-K and inhibition of mRNA translation.
10809782 2000 Interaction of two multifunctional proteins. Heterogeneous nuclear ribonucleoprotein K and Y-box-binding protein.
10772858 2000 Protein-protein interaction among hnRNPs shuttling between nucleus and cytoplasm.
10749975 2000 RBMY, a probable human spermatogenesis factor, and other hnRNP G proteins interact with Tra2beta and affect splicing.
10369774 1999 High precision solution structure of the C-terminal KH domain of heterogeneous nuclear ribonucleoprotein K, a c-myc transcription factor.
10329716 1999 Regulated interaction of protein kinase Cdelta with the heterogeneous nuclear ribonucleoprotein K protein.
9651361 1998 Hepatitis C virus core protein interacts with heterogeneous nuclear ribonucleoprotein K.
9553145 1998 Identification of heterogeneous nuclear ribonucleoprotein K (hnRNP K) as a repressor of C/EBPbeta-mediated gene activation.
9185665 1997 Molecular cloning of Fyn-associated molecules in the mouse central nervous system.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8833161 1996 Assignment of human KH-box-containing genes by in situ hybridization: HNRNPK maps to 9q21.32-q21.33, PCBP1 to 2p12-p13, and PCBP2 to 12q13.12-q13.13, distal to FRA12A.
8810341 1996 Identification of Itk/Tsk Src homology 3 domain ligands.
8628302 1996 Heterogeneous nuclear ribonucleoprotein K is a transcription factor.
8398153 1993 Nova, the paraneoplastic Ri antigen, is homologous to an RNA-binding protein and is specifically expressed in the developing motor system.
8152927 1994 Tissue specific expression and cDNA structure of a human transcript encoding a nucleic acid binding [oligo(dC)] protein related to the pre-mRNA binding protein K.
8107114 1994 Identification, molecular cloning, expression and chromosome mapping of a family of transformation upregulated hnRNP-K proteins derived by alternative splicing.
8051112 1994 Novel signaling pathway suggested by SH3 domain-mediated p95vav/heterogeneous ribonucleoprotein K interaction.
7862126 1995 Association of the vav proto-oncogene product with poly(rC)-specific RNA-binding proteins.
7516469 1994 Identification of Src, Fyn, and Lyn SH3-binding proteins: implications for a function of SH3 domains.
1729596 1992 Characterization and primary structure of the poly(C)-binding heterogeneous nuclear ribonucleoprotein complex K protein.