Property Summary

NCBI Gene PubMed Count 28
PubMed Score 33.80
PubTator Score 41.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.204 3.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.045 2.9e-03
Breast cancer 3.400 3.0e-02
dermatomyositis 1.100 2.2e-03
Multiple myeloma 1.887 1.4e-03
ovarian cancer -1.900 1.8e-03

Gene RIF (9)

AA Sequence

MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEEEVKLA      1 - 70
LKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNG     71 - 140
MTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPY    141 - 210
DRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG    211 - 280
SSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKA    281 - 350
NMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY    351 - 420
GGGYGGQSSMSGYDQVLQENSSDYQSNLA                                             421 - 449
//

Text Mined References (40)

PMID Year Title