Property Summary

NCBI Gene PubMed Count 56
PubMed Score 47.91
PubTator Score 25.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
ependymoma 1.200 4.6e-02
psoriasis -1.300 1.7e-04
osteosarcoma 2.169 6.6e-04
group 3 medulloblastoma 2.600 1.8e-03
cystic fibrosis -1.185 1.4e-03
astrocytoma 1.300 1.7e-02
glioblastoma 1.200 2.6e-02
medulloblastoma, large-cell 1.400 2.3e-04
autosomal dominant Emery-Dreifuss muscul... 1.222 2.3e-03
acute quadriplegic myopathy 1.220 6.4e-05
Atopic dermatitis 1.900 1.2e-02
intraductal papillary-mucinous adenoma (... 1.100 2.3e-03
aldosterone-producing adenoma -1.675 7.9e-03
Pick disease -1.400 2.8e-04
progressive supranuclear palsy -1.200 3.9e-02
ovarian cancer -1.600 7.2e-06

Gene RIF (24)

PMID Text
26367347 vRSF3 and hnRNP H1 are the first splicing factors identified which regulate the production of these functionally distinct HER2 splice variants and therefore maybe important for the regulation of HER2 signaling.
26282582 Global splicing analysis with RNA-seq revealed that exons carrying the hnRNP H-binding GGGGG motif are predisposed to be skipped compared to those carrying the SRSF1-binding GGAGG motif in both human and mouse brains.
25169827 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
24690621 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
23673860 In pediatric T-acute lymphoblastic leukemia, we have identified 2 RNA processing genes, that is, HNRNPH1/5q35 and DDX3X/Xp11.3 as new MLLT10 fusion partners.
23261416 These results support a working hypothesis that a late viral protein HPV16 L1, which is down regulated by hnRNP H early in the viral life cycle may provide an auto-regulatory positive feedback loop that allows the rapid production of HPV capsid proteins through suppression of the function of hnRNP H at the late stage of the viral life cycle.
23255806 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
23125841 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
22792276 The REST N exon is a very versatile sequence with a complex array of splicing signals, and its activation in H69 cells depends on the relative amounts of hnRNP H and U2AF65.
22207023 These results suggest that increased level of hnRNP-H and PDIA3 expression in Dengue virus infected THP1 cells assist in the viral replication by suppressing the TNF-alpha production.
22174317 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
21915099 hnRNPH activity appears to be involved in the pathogenesis and progression of malignant gliomas as the centre of a splicing oncogenic switch
21823664 spatial interactions of hnRNPH1, NF45, and C14orf166 with HCVc174 likely modulate HCV or cellular functions during acute and chronic HCV infection
21705779 Insight on the crucial role of hnRNP H1 in the regulation of the alternative splicing of the rpL3 gene.
21194727 Nuclear heterogeneous nuclear ribonucleo-protein H expression was related to survival in colorectal cancer.
21068389 altered function of hnRNP H1/H2 in tumor cells is a novel determinant of aberrant thymidine phosphorylase splicing thereby resulting in acquired chemoresistance to TP-activated fluoropyrimidine anticancer drugs.
20308327 Results suggest that hnRNP H and F are nuclear shuttling proteins whose posttranslational modifications may alter interaction with transportin 1, nuclear localization, and hence function.
20145135 A-Raf prevents cancer cell apoptosis contingent on the expression of the heterogeneous nuclear ribonucleoprotein H (hnRNP H) splice factor, which is required for the correct transcription and expression of a-raf.
20100605 working model in which rpL3 recruits hnRNP H1 and, through cooperation with other splicing factors, promotes selection of the alternative splice site
20028692 the G-stretches within exon 9B regulate RAGE alternative splicing via interaction with hnRNP H
19926721 Interactions between different hnRNP proteins bound to distinct locations on a pre-mRNA can change its conformation to affect splicing decisions.
19425502 the discovery overexpression of GPD1 and RRBP1 proteins and lack of expression for HNRNPH1 and SERPINB6 proteins which are new candidate biomarkers of colon cancer.
19244236 hnRNPH and F regulate DM20 splicing by recruiting U1snRNP and hnRNPH plays a primary role in DM20 splice site selection in vivo
18854154 Knockdown of heterogeneous nuclear ribonucleoprotein H1 (HNRNPH1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MMLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLA      1 - 70
LKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNG     71 - 140
ITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPY    141 - 210
DRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG    211 - 280
STFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKA    281 - 350
NMQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY    351 - 420
GGGYGGQSSMSGYDQVLQENSSDFQSNIA                                             421 - 449
//

Text Mined References (68)

PMID Year Title
26367347 2015 SRSF3 and hnRNP H1 regulate a splicing hotspot of HER2 in breast cancer cells.
26282582 2015 SRSF1 and hnRNP H antagonistically regulate splicing of COLQ exon 16 in a congenital myasthenic syndrome.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23673860 2013 New MLLT10 gene recombinations in pediatric T-acute lymphoblastic leukemia.
23261416 2013 Specific interaction between hnRNP H and HPV16 L1 proteins: implications for late gene auto-regulation enabling rapid viral capsid protein production.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22792276 2012 Binding of hnRNP H and U2AF65 to respective G-codes and a poly-uridine tract collaborate in the N50-5'ss selection of the REST N exon in H69 cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22207023 2012 Dengue virus infection induces upregulation of hn RNP-H and PDIA3 for its multiplication in the host cell.
21915099 2011 Splicing factor hnRNPH drives an oncogenic splicing switch in gliomas.
21823664 2011 Identification of hnRNPH1, NF45, and C14orf166 as novel host interacting partners of the mature hepatitis C virus core protein.
21705779 2011 Autoregulatory circuit of human rpL3 expression requires hnRNP H1, NPM and KHSRP.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21194727 2011 The expression profile of RNA-binding proteins in primary and metastatic colorectal cancer: relationship of heterogeneous nuclear ribonucleoproteins with prognosis.
21068389 2011 Heterogeneous nuclear ribonucleoprotein H1/H2-dependent unsplicing of thymidine phosphorylase results in anticancer drug resistance.
20308327 2010 A glycine-rich domain of hnRNP H/F promotes nucleocytoplasmic shuttling and nuclear import through an interaction with transportin 1.
20145135 2010 Heterogeneous nuclear ribonucleoprotein H blocks MST2-mediated apoptosis in cancer cells by regulating A-Raf transcription.
20100605 hnRNP H1 and intronic G runs in the splicing control of the human rpL3 gene.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20028692 2010 Regulation of alternative splicing of the receptor for advanced glycation endproducts (RAGE) through G-rich cis-elements and heterogenous nuclear ribonucleoprotein H.
19946888 2010 Defining the membrane proteome of NK cells.
19926721 2010 hnRNP A1 and hnRNP H can collaborate to modulate 5' splice site selection.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19425502 [Colorectal cancer 2D-proteomics: identification of altered protein expression].
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19299493 2009 Biochemical and genetic evidence for a role of IGHMBP2 in the translational machinery.
19244236 2009 Heterogeneous nuclear ribonucleoproteins H and F regulate the proteolipid protein/DM20 ratio by recruiting U1 small nuclear ribonucleoprotein through a complex array of G runs.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16946708 2006 Interaction of muscleblind, CUG-BP1 and hnRNP H proteins in DM1-associated aberrant IR splicing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14980514 2004 Heterogeneous nuclear ribonucleoproteins F and H/H' show differential expression in normal and selected cancer tissues.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11003644 2000 Cooperative assembly of an hnRNP complex induced by a tissue-specific homolog of polypyrimidine tract binding protein.
10456323 1999 hnRNPs H, H' and F behave differently with respect to posttranslational cleavage and subcellular localization.
9973292 1999 Mapping of primary congenital lymphedema to the 5q35.3 region.
9858532 1999 hnRNP H is a component of a splicing enhancer complex that activates a c-src alternative exon in neuronal cells.
9111328 1997 Interaction between the human nuclear cap-binding protein complex and hnRNP F.
7512260 1994 The hnRNP F protein: unique primary structure, nucleic acid-binding properties, and subcellular localization.
7499401 1995 Heterogeneous nuclear ribonucleoproteins H, H', and F are members of a ubiquitously expressed subfamily of related but distinct proteins encoded by genes mapping to different chromosomes.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.