Property Summary

NCBI Gene PubMed Count 45
PubMed Score 35.09
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 7.2e-10
group 3 medulloblastoma 1.500 3.1e-03
non primary Sjogren syndrome sicca 1.200 2.4e-02
lung adenocarcinoma 1.042 1.1e-04

Gene RIF (18)

PMID Text
25169827 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
24978456 hnRNP F is a co-factor in a subset of tristetraprolin/BRF1/BRF2-mediated mRNA decay.
24690621 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
24316072 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
23255806 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
23125841 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
22174317 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
22132154 These data point to a functional interaction between hnRNP F and SRSF1 as a mutant that eliminates SRSF1 binding to exon 11, or a SRSF1 knockdown, which prevents the stimulatory effect of hnRNP F over expression.
21625959 this result suggests that hnRNP F directs formation of the exon 4 minus variant of ENOX2.
20526337 The study shows solution structures of the three quasi-RNA-recognition motifs of heterogeneous nuclear ribonucleoprotein F in complex with G-tract RNA.
20308327 Results suggest that hnRNP H and F are nuclear shuttling proteins whose posttranslational modifications may alter interaction with transportin 1, nuclear localization, and hence function.
20308064 heterogeneous ribonucleoprotein F is involved in the regulation of cell proliferation via the mammalian target of rapamycin/S6 kinase 2 pathway
19244236 hnRNPH and F regulate DM20 splicing by recruiting U1snRNP and hnRNPH plays a primary role in DM20 splice site selection in vivo
18187620 Knockdown of heterogeneous nuclear ribonucleoprotein F (HNRNPF) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16885237 The solution structure of the three quasi RNA recognition motifs of hnRNP F and identification of the residues that are important for the interaction with the Bcl-x RNA.
16424007 high levels of hnRNP F are present in premalignant and malignant stages of colorectal cancer, reflecting a role for this protein early in colorectal tumorigenesis
16385451 Observational study of gene-disease association. (HuGE Navigator)
11158309 Shows that hnRNPF regulates the 3' end cleavage reaction.

AA Sequence

MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMA      1 - 70
LKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNG     71 - 140
ITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPY    141 - 210
DRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSE    211 - 280
FTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRA    281 - 350
NMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD         351 - 415
//

Text Mined References (60)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
24978456 2014 hnRNP F complexes with tristetraprolin and stimulates ARE-mRNA decay.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22132154 2011 hnRNP A1 and hnRNP F modulate the alternative splicing of exon 11 of the insulin receptor gene.
21625959 2011 hnRNP F directs formation of an exon 4 minus variant of tumor-associated NADH oxidase (ENOX2).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20526337 2010 Structural basis of G-tract recognition and encaging by hnRNP F quasi-RRMs.
20308327 2010 A glycine-rich domain of hnRNP H/F promotes nucleocytoplasmic shuttling and nuclear import through an interaction with transportin 1.
20308064 2010 Involvement of heterogeneous ribonucleoprotein F in the regulation of cell proliferation via the mammalian target of rapamycin/S6 kinase 2 pathway.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19244236 2009 Heterogeneous nuclear ribonucleoproteins H and F regulate the proteolipid protein/DM20 ratio by recruiting U1 small nuclear ribonucleoprotein through a complex array of G runs.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16885237 2006 NMR structure of the three quasi RNA recognition motifs (qRRMs) of human hnRNP F and interaction studies with Bcl-x G-tract RNA: a novel mode of RNA recognition.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16424007 2006 Altered expression and localization of creatine kinase B, heterogeneous nuclear ribonucleoprotein F, and high mobility group box 1 protein in the nuclear matrix associated with colon cancer.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15161980 2004 Sumoylation of heterogeneous nuclear ribonucleoproteins, zinc finger proteins, and nuclear pore complex proteins: a proteomic analysis.
14980514 2004 Heterogeneous nuclear ribonucleoproteins F and H/H' show differential expression in normal and selected cancer tissues.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11158309 2001 hnRNP F influences binding of a 64-kilodalton subunit of cleavage stimulation factor to mRNA precursors in mouse B cells.
11054566 2000 Evidence that dim1 associates with proteins involved in pre-mRNA splicing, and delineation of residues essential for dim1 interactions with hnRNP F and Npw38/PQBP-1.
11003644 2000 Cooperative assembly of an hnRNP complex induced by a tissue-specific homolog of polypyrimidine tract binding protein.
10620016 1999 Heterogeneous nuclear RNA-ribonucleoprotein F binds to DNA via an oligo(dG)-motif and is associated with RNA polymerase II.
10456323 1999 hnRNPs H, H' and F behave differently with respect to posttranslational cleavage and subcellular localization.
9858532 1999 hnRNP H is a component of a splicing enhancer complex that activates a c-src alternative exon in neuronal cells.
9111328 1997 Interaction between the human nuclear cap-binding protein complex and hnRNP F.
7512260 1994 The hnRNP F protein: unique primary structure, nucleic acid-binding properties, and subcellular localization.
7499401 1995 Heterogeneous nuclear ribonucleoproteins H, H', and F are members of a ubiquitously expressed subfamily of related but distinct proteins encoded by genes mapping to different chromosomes.
1351868 1992 Identification and characterization of a gene at D10S94 in the MEN2A region.