Tbio | Heterogeneous nuclear ribonucleoprotein D-like |
Acts as a transcriptional regulator. Promotes transcription repression. Promotes transcription activation in differentiated myotubes (By similarity). Binds to double- and single-stranded DNA sequences. Binds to the transcription suppressor CATR sequence of the COX5B promoter (By similarity). Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Binds both to nuclear and cytoplasmic poly(A) mRNAs. Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers. Binds to the 5'-ACUAGC-3' RNA consensus sequence.
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind to RNAs. Three alternatively spliced transcript variants have been described for this gene. One of the variants is probably not translated because the transcript is a candidate for nonsense-mediated mRNA decay. The protein isoforms encoded by this gene are similar to its family member HNRPD. [provided by RefSeq, May 2011]
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind to RNAs. Three alternatively spliced transcript variants have been described for this gene. One of the variants is probably not translated because the transcript is a candidate for nonsense-mediated mRNA decay. The protein isoforms encoded by this gene are similar to its family member HNRPD. [provided by RefSeq, May 2011]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Limb-Girdle Muscular Dystrophy, Type 1G | 1 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2890 | 8.0e-14 |
Breast cancer | 3578 | 3.7e-11 |
lung adenocarcinoma | 2716 | 3.7e-10 |
malignant mesothelioma | 3232 | 4.6e-07 |
primitive neuroectodermal tumor | 3035 | 2.5e-06 |
medulloblastoma, large-cell | 6241 | 4.3e-06 |
tuberculosis and treatment for 3 months | 179 | 4.5e-06 |
Multiple myeloma | 1332 | 6.7e-06 |
Pick disease | 1894 | 8.6e-06 |
pancreatic cancer | 2398 | 3.1e-05 |
pancreatic carcinoma | 562 | 3.1e-05 |
lung cancer | 4740 | 6.0e-05 |
dermatomyositis | 966 | 1.6e-04 |
atypical teratoid/rhabdoid tumor | 357 | 2.0e-04 |
ovarian cancer | 8520 | 3.0e-04 |
glioblastoma | 5792 | 3.6e-04 |
interstitial lung disease | 298 | 1.1e-03 |
Astrocytoma, Pilocytic | 3081 | 1.5e-03 |
pediatric high grade glioma | 1064 | 1.5e-03 |
Waldenstrons macroglobulinemia | 765 | 2.0e-03 |
ependymoma | 4679 | 1.6e-02 |
progressive supranuclear palsy | 676 | 1.8e-02 |
astrocytic glioma | 2597 | 2.0e-02 |
group 3 medulloblastoma | 4104 | 2.7e-02 |
subependymal giant cell astrocytoma | 2287 | 3.9e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
limb-girdle muscular dystrophy | 37 | 3.457 | 1.7 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Chromosome 4q21 deletion syndrome | 6 | 5.794 | 2.9 |
Disease | Target Count |
---|---|
autosomal dominant limb-girdle muscular dystrophy type 1G | 1 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | 1.600 | 2.0e-02 |
Astrocytoma, Pilocytic | 1.200 | 1.5e-03 |
atypical teratoid/rhabdoid tumor | 1.500 | 2.0e-04 |
Breast cancer | -1.200 | 3.7e-11 |
dermatomyositis | 1.400 | 1.6e-04 |
ependymoma | 1.900 | 1.6e-02 |
glioblastoma | 1.100 | 3.6e-04 |
group 3 medulloblastoma | 1.600 | 2.7e-02 |
interstitial lung disease | -1.500 | 1.1e-03 |
lung adenocarcinoma | -1.400 | 3.7e-10 |
lung cancer | -1.400 | 6.0e-05 |
malignant mesothelioma | 1.500 | 4.6e-07 |
medulloblastoma, large-cell | 1.900 | 4.3e-06 |
Multiple myeloma | 2.279 | 6.7e-06 |
non-small cell lung cancer | -1.004 | 8.0e-14 |
ovarian cancer | -1.300 | 3.0e-04 |
pancreatic cancer | -1.300 | 3.1e-05 |
pancreatic carcinoma | -1.300 | 3.1e-05 |
pediatric high grade glioma | 1.300 | 1.5e-03 |
Pick disease | -1.300 | 8.6e-06 |
primitive neuroectodermal tumor | 1.400 | 2.5e-06 |
progressive supranuclear palsy | -1.300 | 1.8e-02 |
subependymal giant cell astrocytoma | -1.320 | 3.9e-02 |
tuberculosis and treatment for 3 months | 1.100 | 4.5e-06 |
Waldenstrons macroglobulinemia | 1.573 | 2.0e-03 |
MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRHVTAQQPSRLA 1 - 70 GGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEEFAEGSKINA 71 - 140 SKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 141 - 210 HKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFIT 211 - 280 YTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGF 281 - 350 NNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY 351 - 420 //