Property Summary

NCBI Gene PubMed Count 118
PubMed Score 168.18
PubTator Score 139.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Gene RIF (81)

AA Sequence

MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDA      1 - 70
SKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGF     71 - 140
GFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVES    141 - 210
IELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRAR    211 - 280
GRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQN    281 - 350
SYKPY                                                                     351 - 355
//

Text Mined References (137)

PMID Year Title