Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.46
PubTator Score 22.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.317 3.7e-07
astrocytoma 1.600 4.6e-04
glioblastoma 1.700 9.5e-03
group 3 medulloblastoma 1.800 1.2e-05
lung cancer 1.100 2.8e-03
medulloblastoma, large-cell 1.200 5.0e-05
Multiple myeloma 2.142 1.9e-05
ovarian cancer 1.900 8.9e-05
primary pancreatic ductal adenocarcinoma 1.258 1.9e-03
primitive neuroectodermal tumor 1.100 2.2e-04
psoriasis 1.600 1.1e-04
Waldenstrons macroglobulinemia 1.501 4.5e-03

Gene RIF (4)

AA Sequence

MSEAGEEQPMETTGATENGHEAVPEASRGRGWTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGK      1 - 70
MFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVID     71 - 140
PKKAMAMKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKK    141 - 210
VLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGY    211 - 280
GYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY                      281 - 332
//

Text Mined References (35)

PMID Year Title