Property Summary

NCBI Gene PubMed Count 19
PubMed Score 20.50
PubTator Score 11.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.625 2.3e-03
Multiple myeloma 1.675 1.8e-03
malignant mesothelioma 1.100 7.6e-06
psoriasis -1.700 3.0e-04
osteosarcoma -1.114 1.2e-03
medulloblastoma, large-cell 1.200 1.7e-05
autosomal dominant Emery-Dreifuss muscul... 1.030 3.4e-03
hereditary spastic paraplegia -1.006 2.7e-02
acute quadriplegic myopathy 1.228 3.3e-05
Breast cancer 1.900 4.0e-02
group 4 medulloblastoma 1.200 2.6e-04
primary Sjogren syndrome 1.100 3.5e-02
lung adenocarcinoma 1.017 2.1e-04
ovarian cancer -2.200 4.3e-07
dermatomyositis 2.000 8.9e-05

Gene RIF (7)

PMID Text
23827524 The results of this study suggested that mutations in hnRNPA1, A2/B1, and A3 genes are a rare finding in amyotrophic lateral sclerosis.
23166591 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
22546510 characterization of hnRNP A3 in human and mouse cell lines
22174317 Expression of HIV-1 Tat upregulates the abundance of heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) in the nucleoli of Jurkat T-cells
20600361 Results suggest that hnRNP A3 is associated with telomere in vivo and acts as a negative regulator of telomere length maintenance.
17919748 These biochemical properties of hnRNP A3 suggest that hnRNP A3 can participate in telomere regulation in vivo.

AA Sequence

MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDP      1 - 70
QTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEY     71 - 140
NLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSA    141 - 210
GSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGG    211 - 280
PGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGS    281 - 350
FGGRSSGSPYGGGYGSGGGSGGYGSRRF                                              351 - 378
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23827524 2013 Analysis of hnRNPA1, A2/B1, and A3 genes in patients with amyotrophic lateral sclerosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22546510 2012 Expression profile and interactions of hnRNP A3 within hnRNP/mRNP complexes in mammals.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20600361 2010 Telomeric DNA-binding activities of heterogeneous nuclear ribonucleoprotein A3 in vitro and in vivo.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17919748 2008 Heterogeneous nuclear ribonucleoprotein A3 binds single-stranded telomeric DNA and inhibits telomerase extension in vitro.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15776420 2005 HnRNP A3 genes and pseudogenes in the vertebrate genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11886857 2002 Heterogeneous nuclear ribonucleoprotein A3, a novel RNA trafficking response element-binding protein.
8101480 1993 Identification and characterization of a cDNA, which is highly homologous to the ribonucleoprotein gene, from a locus (D10S102) closely linked to MEN2 (multiple endocrine neoplasia type 2).
8093642 1993 A 1.5-megabase yeast artificial chromosome contig from human chromosome 10q11.2 connecting three genetic loci (RET, D10S94, and D10S102) closely linked to the MEN2A locus.