Property Summary

NCBI Gene PubMed Count 21
PubMed Score 21.10
PubTator Score 11.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.228 3.3e-05
autosomal dominant Emery-Dreifuss muscul... 1.030 3.4e-03
Breast cancer 1.900 4.0e-02
dermatomyositis 2.000 8.9e-05
group 3 medulloblastoma 1.100 1.3e-02
hereditary spastic paraplegia -1.006 2.7e-02
lung adenocarcinoma 1.017 2.1e-04
malignant mesothelioma 1.100 7.6e-06
medulloblastoma, large-cell 1.200 1.7e-05
Multiple myeloma 1.108 1.9e-02
osteosarcoma -1.114 1.2e-03
ovarian cancer -1.100 9.1e-04
primary Sjogren syndrome 1.100 3.5e-02
psoriasis -1.700 3.0e-04
Waldenstrons macroglobulinemia 1.600 1.2e-02

Gene RIF (9)

AA Sequence

MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDP      1 - 70
QTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEY     71 - 140
NLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSA    141 - 210
GSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGG    211 - 280
PGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGS    281 - 350
FGGRSSGSPYGGGYGSGGGSGGYGSRRF                                              351 - 378
//

Text Mined References (38)

PMID Year Title