Property Summary

NCBI Gene PubMed Count 107
PubMed Score 195.36
PubTator Score 176.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.094 1.3e-03
Multiple myeloma 1.951 2.9e-04
astrocytic glioma 2.500 5.5e-03
ependymoma 2.800 9.8e-04
oligodendroglioma 2.300 1.3e-02
glioblastoma multiforme 1.300 4.1e-23
group 3 medulloblastoma 1.800 3.4e-03
atypical teratoid / rhabdoid tumor -1.100 1.6e-05
medulloblastoma, large-cell -1.100 6.1e-03
primitive neuroectodermal tumor 1.300 6.9e-03
juvenile dermatomyositis 1.002 8.0e-08
acute quadriplegic myopathy 1.149 2.7e-04
primary pancreatic ductal adenocarcinoma 1.342 2.5e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-02
adult high grade glioma -1.200 2.1e-04
Polycystic Ovary Syndrome 1.753 3.3e-03
Pick disease -3.200 3.8e-07
progressive supranuclear palsy -2.800 3.7e-03
ovarian cancer -2.700 8.2e-09
pancreatic cancer 1.400 4.6e-03

Gene RIF (74)

PMID Text
26805816 hnRNPA2B1, hnRNPD, hnRNPL , and YBX1 might play important roles in gastric cancer tumorigenesis.
26321680 Study finds that the RNA-binding protein HNRNPA2B1 binds m(6)A-bearing RNAs in vivo and in vitro and its biochemical footprint matches the m(6)A consensus motif. HNRNPA2B1 directly binds a set of nuclear transcripts and elicits similar alternative splicing effects as the m(6)A writer METTL3.
26176628 A unique role of the embryonic miR-369-HNRNPA2B1 axis in controlling metabolic enzyme function.
26011126 lowering the levels of hnRNP A1/A2 elicits defective transcription elongation on a fraction of P-TEFb-dependent genes, hence favoring the transcription of P-TEFb-independent genes
25483567 Tissue analysis and knockdown of hnRNPA2B1 using siRNA subsequently demonstrated both the overexpression and potential role for this molecule in lung tumorigenesis.
25378556 Nuclear TDP-43 becomes neurotoxic by escaping from the inhibitory regulation by hnRNP-U or hnRNP-A2.
25169827 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
25124043 data suggest that a prominent down-regulation of hnRNP-A2/B1 during hypoxia is associated with the post-transcriptional suppression of hASH1 synthesis.
24998203 In KRAS-dependent pancreatic ductal adenocarcinoma cell lines, HNRNPA2B1 interacts with and regulates the activity of KRAS G12V and G12D.
24920338 TDP-43 suppresses CGG-mediated toxicity through interactions with hnRNP A2/B1 and suggest a convergence of pathogenic cascades between repeat expansion disorders and RNA-binding proteins implicated in neurodegenerative disease.
24823909 Cytoplasmic hnRNPA2 may affect the cancer cell phenotype through 3'-UTR mRNA-mediated regulation of beta-catenin expression and other cancer-relevant genes.
24690621 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
24675500 Results demonstrate that by regulating DNA-Protein Kinase activity, hnRNP B1 can affect p53-mediated cell cycle progression and apoptosis, resulting in greater cell survival and subsequent proliferation in human adenocarcinoma of the lungs.
24612671 Its mutation is proved to be a rare cause of amyotrophic lateral sclerosis, frontotemporal dementia, and inclusion body myopathy. in the nertherlands.
24418537 hnRNP A2/B1 plays an inhibitory role in the replication of influenza A virus through suppressing NS1 RNA/protein levels and NS1 mRNA nucleocytoplasmic translocation.
24376828 P55-70 of hnRNP B1 is a potential biomarker for autoimmune hepatitis in immunological tests.
24356509 hnRNPA2B1 is a key player in miRNA sorting into exosomes
24157614 Rsults demonstrate that hnRNP A2/B1 expression plays roles in the nuclear retention of the HIV-1 genomic RNA in the absence of Rev and in the release of the genomic RNA from translationally inactive, cytoplasmic RNP complexes.
24119545 Its mutation is rare in patients with frontotemporal lobar degeneration.
24098712 Arginine methylation of hnRNP A2 does not directly govern its subcellular localization.
23827524 The results of this study suggested that mutations in hnRNPA1, A2/B1, and A3 genes are a rare finding in amyotrophic lateral sclerosis.
23697369 Data indicate that apigenin binds to the C-terminal glycine-rich domain of hnRNPA2, preventing hnRNPA2 from forming homodimers, and therefore, it perturbs the alternative splicing of several hnRNPA2 targets.
23658645 HnRNP A1/A2 and SF2/ASF regulate alternative splicing of interferon regulatory factor-3 and affect immunomodulatory functions in human non-small cell lung cancer cells.
23593027 our data suggest a novel type of gene regulation: a coordinated transcription or silencing of gene clusters delimited by DSB hot spots as well as PARP1 and HNRNPa2B1 binding sites.
23455423 definition of pathogenic mutations in PrLDs of heterogeneous nuclear ribonucleoproteins (hnRNPs) A2B1 and A1 in families with inherited degeneration affecting muscle, brain, motor neuron and bone, and in one case of familial amyotrophic lateral sclerosis
23255806 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
23166591 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
23125841 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
22944692 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
22628224 These findings present cholinergic-mediated hnRNP A/B loss and impaired RNA metabolism as important mechanisms involved in Alzheimer's disease.
22484615 hnRNP A2/B1 protein is a regulator of HPV-16 late gene expression
22372738 Heterogeneous nuclear ribonucleoprotein A2/B1, an human telomerase reverse transcriptase - associated protein, is a potential prognostic biomarker for hepatocellular carcinoma patients
22325225 The positive expression rate of hnRNPA2/B1 in small cell lung cancer was significantly higher than that in the control specimens.
22205302 Patient serum IgA was reactve against human recombinant hnRNP-A2/B1 in Behcet (83.3%), systemic lupus erythematosus (13.3%), rheumatoid arthritis (26.7%), Takayasu's arteritis (30%), and no IgA nephropathy patients, vs healthy controls (20%).
22187150 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
22174317 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
21865391 In addition to the core protein, hnRNP A2 also associated with Japanese encephalitis virus nonstructural protein 5 and with the 5'-untranslated region of the negative-sense Japanese encephalitis virus RNA.
21858080 Data show that hnRNPA1/A2, HuR and DAZAP1 splicing factors and DHX36 RNA helicase bind to the ISE, with hnRNPA1 acting negatively and DAZAP1 positively on splicing selection.
21642356 High HNRPA2B1 expression is associated with pancreatic cancer progression.
21547579 The impact of VHL genetic alterations on the expression of several pVHL protein targets in paired normal and tumor tissue, was evaluated.
21321999 The expression and distribution of hnRNP A2/B1 can affect the differentiation of SK-N-SH cells, as well as its co-localization with related oncogenes and tumor suppressor genes
21175803 hnRNP-A2/B1 affected tumor cell differentiation through interaction with oncogenes and tumor-suppressor genes, and it was overexpressed in human gastric cancer.
20978319 hnRNP A2/B1 and osteopontin expression was variable in CCRCCs and had no association with VHL genetic status.
20946641 A conserved nonsense-mediated mRNA decay event within HNRNPA2B1 that appears to mediate autoregulation of HNRNPA2B1 expression levels, was identified upon UPF1 knockdown .
20604928 Increased expression and cytoplasmic localization of hnRNP A2/B1 is associated with the development of hepatocellular carcinoma.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20232340 These data suggest involvement of hnRNP-A2 specific cellular autoimmune responses in rheumatoid arthritis pathogenesis
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20181627 melanoma antigen expressed in G361, a representative melanoma cell line/ reacted with autoantibodies in patient sera
20133837 splicing repressors hnRNP A1 and A2, as well as the polypyrimidine-tract-binding protein PTB, contribute to control of pyruvate kinase isoform M1 and M2 expression
20016921 Proteins hnRNP F, hnRNP H, and hnRNP A2/B1 bind to the intronic G run (G13-2: AGGGA) to regulate the levels of vif and vpr mRNA, and the amounts of Vif and Vpr protein expression
20010808 human gliomas overexpress c-Myc, PTB, hnRNPA1 and hnRNPA2 in a manner that correlates with PKM2 expression
19934309 Alternative splicing of an exon in the 5' untranslated region of a gene termed TP53INP2 is a key event downstream of hnRNP A2 that is necessary for cells to invade the extracellular matrix.
19609729 Neither grade nor stage of non-small cell lung carcinomas was correlated with hnRNP B1 immunreactivity
18461365 Detection of plasma hnRNP B1 mRNA by transcription-reverse transcription concerted reaction improves overall prognosis in lung cancer patients.
18391021 The binding of the splicing factors hnRNPA1/A2 and DAZAP1 is the primary determinant of T6 BRCA1 exon 18 exclusion.
18032920 present an investigation of DNA methylation and histone modification marks across the HNRPA2B1-CBX3 locus in primary peripheral blood mononuclear cells to characterise the chromatin structure that underlies UCOE activity
17991743 Data show that nuclear export of heterogeneous nuclear ribonucleoprotein A2 was mediated by CXCR4 and requires Cyclophilin A.
17067748 Increased hnRNP A2/B1 expression is associated with non-small cell lung cancer
17004321 Plays a central role in taking HIV-1 genomic RNA to and from the microtubule-organizing center.
16859514 Pronounced peripheral T cell reactivity to hnRNP-A2 observed in majority of SLE patients and distinct phenotype of patient-derived CD8+ T cell clones suggest role for these T cells in pathogenesis of SLE.
16775011 These results are consistent with a model where hnRNP E1 recruited to A2RE RNA granules by binding to hnRNP A2 inhibits translation of A2RE RNA during granule transport.
16464861 Collagen prolyl 4-hydroxylase-alpha (I)mRNA is stabilized by interation of RNA-binding proteins hnRNP-A2/B1 with a U(16) element within the 3'-UTR
15703215 tumor overexpressed gene mediates the association of hnRNP A2-positive granules with microtubules during transport and/or localization
15659580 hnRNP A2 can bind the telomeric DNA repeat and the RNA component of telomerase.
15567486 Our study suggests that hnRNP B1-associated post-transcriptional regulations are preserved in the inferior temporal cortex of Alzheimer's disease.
15375589 In human small airway epithelial cells, hnRNP A2 as well as B1 were expressed primarily in the nucleus excluding the nucleolus
15147968 hnRNP A2 acts on GLUT1 mRNA to inhibit expression of GLUT1 in a brain cancer cell line.
12945950 Involved in mRNA processing and mRNA nucleocytoplasmic export. Sequestered in intranuclear aggregates. Oculopharyngeal muscular dystrophy intranuclear inclusions are "poly(A) RNA traps", interfering with RNA export and causing muscle cell death.
12243756 These data suggest that the RBDII domain of hnRNP A2 targets hnRNP A2 to the periphery of the cell in a microtubule-dependent manner.
12097415 Synovial overexpression of HNRNPA2 in rheumatoid arthritis (RA) patients in conjunction with the presence of autoreactive Th1-like cells indicates potential involvement of HNRNPA2 in the pathogenesis of RA.
12065097 Increased expression of heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP) in pancreatic tissue from smokers and pancreatic tumor cells.
12060656 hnRNP A1/A2 binding sites control 5' splice site selection in the hnRNP A1 mRNA precursor
11771750 Increased protein levels of heterogeneous nuclear ribonucleoprotein A2/B1 in fetal Down syndrome brains.

AA Sequence

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFS      1 - 70
SMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDT     71 - 140
IEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFG    141 - 210
DSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQG    211 - 280
GGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGR    281 - 350
SRY                                                                       351 - 353
//

Text Mined References (133)

PMID Year Title
26805816 2016 Unraveling Molecular Differences of Gastric Cancer by Label-Free Quantitative Proteomics Analysis.
26544936 2015 The LC Domain of hnRNPA2 Adopts Similar Conformations in Hydrogel Polymers, Liquid-like Droplets, and Nuclei.
26321680 2015 HNRNPA2B1 Is a Mediator of m(6)A-Dependent Nuclear RNA Processing Events.
26176628 2015 Embryonic MicroRNA-369 Controls Metabolic Splicing Factors and Urges Cellular Reprograming.
26011126 2015 A Function for the hnRNP A1/A2 Proteins in Transcription Elongation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25483567 2015 Abnormal levels of heterogeneous nuclear ribonucleoprotein A2B1 (hnRNPA2B1) in tumour tissue and blood samples from patients diagnosed with lung cancer.
25378556 2015 Nuclear TDP-43 causes neuronal toxicity by escaping from the inhibitory regulation by hnRNPs.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25124043 2014 Shutdown of achaete-scute homolog-1 expression by heterogeneous nuclear ribonucleoprotein (hnRNP)-A2/B1 in hypoxia.
24998203 2014 Ribonucleoprotein HNRNPA2B1 interacts with and regulates oncogenic KRAS in pancreatic ductal adenocarcinoma cells.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24920338 2014 TDP-43 suppresses CGG repeat-induced neurotoxicity through interactions with HnRNP A2/B1.
24823909 2014 The RNA-binding protein hnRNPA2 regulates ?-catenin protein expression and is overexpressed in prostate cancer.
24675500 Mechanisms underlying regulation of cell cycle and apoptosis by hnRNP B1 in human lung adenocarcinoma A549 cells.
24612671 2014 No mutations in hnRNPA1 and hnRNPA2B1 in Dutch patients with amyotrophic lateral sclerosis, frontotemporal dementia, and inclusion body myopathy.
24549040 2014 C9ORF72, implicated in amytrophic lateral sclerosis and frontotemporal dementia, regulates endosomal trafficking.
24418537 2014 hnRNP A2/B1 interacts with influenza A viral protein NS1 and inhibits virus replication potentially through suppressing NS1 RNA/protein levels and NS1 mRNA nuclear export.
24376828 2013 SPRi-based strategy to identify specific biomarkers in systemic lupus erythematosus, rheumatoid arthritis and autoimmune hepatitis.
24356509 2013 Sumoylated hnRNPA2B1 controls the sorting of miRNAs into exosomes through binding to specific motifs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24157614 2013 Depletion of hnRNP A2/B1 overrides the nuclear retention of the HIV-1 genomic RNA.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24119545 2014 hnRNPA2B1 and hnRNPA1 mutations are rare in patients with "multisystem proteinopathy" and frontotemporal lobar degeneration phenotypes.
24098712 2013 Arginine methylation of hnRNP A2 does not directly govern its subcellular localization.
23827524 2013 Analysis of hnRNPA1, A2/B1, and A3 genes in patients with amyotrophic lateral sclerosis.
23697369 2013 Molecular basis for the action of a dietary flavonoid revealed by the comprehensive identification of apigenin human targets.
23658645 2013 HnRNP A1/A2 and SF2/ASF regulate alternative splicing of interferon regulatory factor-3 and affect immunomodulatory functions in human non-small cell lung cancer cells.
23593027 2013 DNA double-strand breaks coupled with PARP1 and HNRNPA2B1 binding sites flank coordinately expressed domains in human chromosomes.
23455423 2013 Mutations in prion-like domains in hnRNPA2B1 and hnRNPA1 cause multisystem proteinopathy and ALS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22628224 2012 Cholinergic-associated loss of hnRNP-A/B in Alzheimer's disease impairs cortical splicing and cognitive function in mice.
22484615 2012 Development and validation of a novel reporter assay for human papillomavirus type 16 late gene expression.
22372738 2012 Heterogeneous nuclear ribonucleoprotein A2/B1 in association with hTERT is a potential biomarker for hepatocellular carcinoma.
22325225 2011 [Expression of EGFR, survivn and hnRNPA2/B1 in bronchial brushing cytology specimens and their significance in diagnosis of lung cancer].
22205302 2012 Identification of HnRNP-A2/B1 as a target antigen of anti-endothelial cell IgA antibody in Behçet's disease.
21865391 2011 Heterogeneous nuclear ribonucleoprotein A2 participates in the replication of Japanese encephalitis virus through an interaction with viral proteins and RNA.
21858080 2011 Interaction of hnRNPA1/A2 and DAZAP1 with an Alu-derived intronic splicing enhancer regulates ATM aberrant splicing.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21642356 2011 Fyn requires HnRNPA2B1 and Sam68 to synergistically regulate apoptosis in pancreatic cancer.
21547579 2011 VHL genetic alteration in CCRCC does not determine de-regulation of HIF, CAIX, hnRNP A2/B1 and osteopontin.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21321999 2011 The localization of hnRNP A2/B1 in nuclear matrix and the aberrant expression during the RA-induced differentiation of human neuroblastoma SK-N-SH cells.
21269460 2011 Initial characterization of the human central proteome.
21175803 2011 Aberrant expression and localization of hnRNP-A2/B1 is a common event in human gastric adenocarcinoma.
20978319 2010 VHL genetic alteration in CCRCC does not determine de-regulation of HIF, CAIX, hnRNP A2/B1 and osteopontin.
20946641 2010 Expression proteomics of UPF1 knockdown in HeLa cells reveals autoregulation of hnRNP A2/B1 mediated by alternative splicing resulting in nonsense-mediated mRNA decay.
20604928 2010 Up-regulation and subcellular localization of hnRNP A2/B1 in the development of hepatocellular carcinoma.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20232340 2010 Immunodominant T-cell epitopes of hnRNP-A2 associated with disease activity in patients with rheumatoid arthritis.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20181627 Identification of melanoma antigens using a Serological Proteome Approach (SERPA).
20133837 2010 The alternative splicing repressors hnRNP A1/A2 and PTB influence pyruvate kinase isoform expression and cell metabolism.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20010808 2010 HnRNP proteins controlled by c-Myc deregulate pyruvate kinase mRNA splicing in cancer.
19946888 2010 Defining the membrane proteome of NK cells.
19934309 2009 hnRNP A2 regulates alternative mRNA splicing of TP53INP2 to control invasive cell migration.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19609729 2010 Comparison of osteopontin, beta-catenin and hnRNP B1 expression in lung carcinomas.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19429692 2009 Functional mapping of the interaction between TDP-43 and hnRNP A2 in vivo.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19099192 2009 Nuclear functions of heterogeneous nuclear ribonucleoproteins A/B.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519039 2008 The p53 target protein Wig-1 binds hnRNP A2/B1 and RNA Helicase A via RNA.
18461365 2008 Establishment of a new method, transcription-reverse transcription concerted reaction, for detection of plasma hnRNP B1 mRNA, a biomarker of lung cancer.
18391021 2008 Binding of DAZAP1 and hnRNPA1/A2 to an exonic splicing silencer in a natural BRCA1 exon 18 mutant.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18032920 Correlation of DNA methylation with histone modifications across the HNRPA2B1-CBX3 ubiquitously-acting chromatin open element (UCOE).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17991743 2008 Cyclophilin A is required for CXCR4-mediated nuclear export of heterogeneous nuclear ribonucleoprotein A2, activation and nuclear translocation of ERK1/2, and chemotactic cell migration.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17067748 2006 Prognostic and diagnostic relevance of hnRNP A2/B1, hnRNP B1 and S100 A2 in non-small cell lung cancer.
17004321 2006 Trafficking of HIV-1 RNA is mediated by heterogeneous nuclear ribonucleoprotein A2 expression and impacts on viral assembly.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16859514 2006 The spliceosomal autoantigen heterogeneous nuclear ribonucleoprotein A2 (hnRNP-A2) is a major T cell autoantigen in patients with systemic lupus erythematosus.
16775011 2006 Heterogeneous nuclear ribonucleoprotein (hnRNP) E1 binds to hnRNP A2 and inhibits translation of A2 response element mRNAs.
16464861 2006 Heterogeneous nuclear ribonucleoprotein-A2/B1 modulate collagen prolyl 4-hydroxylase, alpha (I) mRNA stability.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16294306 2006 Identification of prion protein binding proteins by combined use of far-Western immunoblotting, two dimensional gel electrophoresis and mass spectrometry.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15703215 2005 The microtubule-associated protein tumor overexpressed gene binds to the RNA trafficking protein heterogeneous nuclear ribonucleoprotein A2.
15659580 2005 hnRNP A2, a potential ssDNA/RNA molecular adapter at the telomere.
15567486 2004 Immunohistochemical study of hnRNP B1 in the postmortem temporal cortices of patients with Alzheimer's disease.
15375589 2004 Expression of hnRNP A2/B1 proteins in small airway epithelial cells.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15294897 2004 A late role for the association of hnRNP A2 with the HIV-1 hnRNP A2 response elements in genomic RNA, Gag, and Vpr localization.
15147968 2004 Post-transcriptional regulation of glucose transporter-1 by an AU-rich element in the 3'UTR and by hnRNP A2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14692562 2003 HnRNP A2/B1 proteins in nontumorous alveolar cells.
14608468 2004 Alterations of heterogeneous nuclear RNP A2 and B1 in the hippocampus of the rat after perforant pathway lesion.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12945950 2003 HnRNP A1 and A/B interaction with PABPN1 in oculopharyngeal muscular dystrophy.
12927788 2003 hLodestar/HuF2 interacts with CDC5L and is involved in pre-mRNA splicing.
12509629 2003 Autoantibodies to dsDNA cross-react with the arginine-glycine-rich domain of heterogeneous nuclear ribonucleoprotein A2 (hnRNP A2) and promote methylation of hnRNP A2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12243756 2002 Intracellular trafficking of hnRNP A2 in oligodendrocytes.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12097415 2002 Characterization of autoreactive T cells to the autoantigens heterogeneous nuclear ribonucleoprotein A2 (RA33) and filaggrin in patients with rheumatoid arthritis.
12065097 2002 Increased expression of heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP) in pancreatic tissue from smokers and pancreatic tumor cells.
12060656 2002 Distinct sets of adjacent heterogeneous nuclear ribonucleoprotein (hnRNP) A1/A2 binding sites control 5' splice site selection in the hnRNP A1 mRNA precursor.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11517223 2001 The von Hippel-Lindau protein interacts with heteronuclear ribonucleoprotein a2 and regulates its expression.
11510693 2001 Differential expression of the early lung cancer detection marker, heterogeneous nuclear ribonucleoprotein-A2/B1 (hnRNP-A2/B1) in normal breast and neoplastic breast cancer.
10978504 2000 Testis- and developmental stage-specific expression of hnRNP A2/B1 splicing isoforms, B0a/b.
10772824 2000 The RGG domain in hnRNP A2 affects subcellular localization.
10567417 1999 Mutational analysis of a heterogeneous nuclear ribonucleoprotein A2 response element for RNA trafficking.
10441480 1999 hnRNP A2 and hnRNP L bind the 3'UTR of glucose transporter 1 mRNA and exist as a complex in vivo.
10381337 1999 Heterogeneous nuclear ribonucleoprotein A2 interacts with protein kinase CK2.
9761751 1998 Expression of heterogeneous nuclear ribonucleoprotein A2/B1 changes with critical stages of mammalian lung development.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9187682 1997 Physical mapping of the HOXA1 gene and the hnRPA2B1 gene in a YAC contig from human chromosome 7p14-p15.
8029005 1994 Two homologous genes, originated by duplication, encode the human hnRNP proteins A2 and A1.
7980541 1994 ADP-ribosylation of heterogeneous ribonucleoproteins in HeLa cells.
7789969 1995 Structure and expression of the gene (HNRPA2B1) encoding the human hnRNP protein A2/B1.
7503735 1995 Differential distribution of heterogeneous nuclear ribonucleoproteins in rat tissues.
3733753 1986 Purification and domain structure of core hnRNP proteins A1 and A2 and their relationship to single-stranded DNA-binding proteins.
2557628 1989 Primary structures of the heterogeneous nuclear ribonucleoprotein A2, B1, and C2 proteins: a diversity of RNA binding proteins is generated by small peptide inserts.
1833625 1991 U1 SnRNP association with HnRNP involves an initial non-specific splice-site independent interaction of U1 SnRNP protein with HnRNA.
1699755 1990 Two-dimensional gel electrophoresis, protein electroblotting and microsequencing: a direct link between proteins and genes.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1522214 1992 Purification and partial sequencing of the nuclear autoantigen RA33 shows that it is indistinguishable from the A2 protein of the heterogeneous nuclear ribonucleoprotein complex.