Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.45
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.462 4.6e-03
group 3 medulloblastoma 2.000 3.2e-04
tuberculosis and treatment for 6 months -1.200 5.1e-03
subependymal giant cell astrocytoma -2.159 1.4e-02
lung adenocarcinoma -1.400 1.6e-15
Breast cancer -1.600 4.2e-21
ovarian cancer -2.200 4.0e-07

Gene RIF (4)

PMID Text
26602816 Data show that heterogeneous nuclear ribonucleoprotein A0 (hnRNPA0) drives chemo-resistance of p53-mutant tumor cells via p27Kip1/Gadd45alpha mRNAs.
24532040 Knockdown of Hnrnpa0, a del(5q) gene, alters myeloid cell fate in murine cells through regulation of AU-rich transcripts.
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A0 (HNRNPA0), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPH      1 - 70
AVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRG     71 - 140
FGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLS    141 - 210
KGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSS    211 - 280
WGGRSNSGPYRGGYGGGGGYGGSSF                                                 281 - 305
//

Text Mined References (29)

PMID Year Title
26602816 2015 A Pleiotropic RNA-Binding Protein Controls Distinct Cell Cycle Checkpoints to Drive Resistance of p53-Defective Tumors to Chemotherapy.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24532040 2014 Knockdown of Hnrnpa0, a del(5q) gene, alters myeloid cell fate in murine cells through regulation of AU-rich transcripts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20932473 2010 DNA damage activates a spatially distinct late cytoplasmic cell-cycle checkpoint network controlled by MK2-mediated RNA stabilization.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456657 2002 Inhibition of SAPK2a/p38 prevents hnRNP A0 phosphorylation by MAPKAP-K2 and its interaction with cytokine mRNAs.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11161817 2001 Transcript map and comparative analysis of the 1.5-Mb commonly deleted segment of human 5q31 in malignant myeloid diseases with a del(5q).
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8325628 1993 Novel triplet repeat containing genes in human brain: cloning, expression, and length polymorphisms.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.
7585247 1995 Isolation and characterization of a novel, low abundance hnRNP protein: A0.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.