Property Summary

NCBI Gene PubMed Count 58
PubMed Score 712.71
PubTator Score 375.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Asthma 349 3.014 1.5
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Cortical blindness 15 3.348 1.7
Arthus reaction 8 3.255 1.6
Cancer 2346 3.161 1.6
Disease Target Count
Asthma, susceptibility to 11
Rhinitis 46

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma 1.500 3.5e-04
astrocytoma 2.300 1.8e-02
glioblastoma 2.200 1.6e-04
oligodendroglioma 1.500 4.9e-08
posterior fossa group B ependymoma 1.500 5.1e-06
medulloblastoma -2.500 1.4e-05
atypical teratoid / rhabdoid tumor -3.100 1.8e-09
medulloblastoma, large-cell -3.800 2.2e-08
primitive neuroectodermal tumor -1.200 2.6e-02
Duchenne muscular dystrophy 1.661 8.0e-08
autosomal dominant Emery-Dreifuss muscul... 1.185 3.3e-03
juvenile dermatomyositis 1.422 9.3e-10
adrenocortical carcinoma -1.552 1.3e-02
tuberculosis 1.200 1.5e-04
non-small cell lung cancer -1.458 6.2e-17
lung cancer -2.800 1.7e-05
active ulcerative colitis -1.340 7.3e-03
interstitial cystitis -1.400 4.2e-04
cystic fibrosis 1.200 3.4e-02
pediatric high grade glioma 1.300 1.4e-03
pilocytic astrocytoma 1.900 2.4e-06
subependymal giant cell astrocytoma 1.623 5.5e-03
Polycystic Ovary Syndrome 1.106 3.4e-02
lung carcinoma -2.200 1.3e-30
Breast cancer -1.100 2.8e-05
ductal carcinoma in situ -1.300 5.8e-03
invasive ductal carcinoma -2.200 3.7e-04
ovarian cancer -3.300 1.0e-08
Gaucher disease type 3 -1.100 4.3e-02

Protein-protein Interaction (2)

Gene RIF (58)

PMID Text
26206890 HNMT is identified as a novel gene responsible for intellectual disability. The consequences of the identified missense mutations on the protein function are discussed.
25909280 HRH1-17 TT and HNMT-1639 TT genotypes were associated with the allergic asthma phenotype among African-American children and that the ABP 4107 GG genotype was associated with nonallergic asthma among white children.
25768024 results suggest that the heterozygous Thr/Ile genotype at the HNMT-Thr105Ile locus and the minor Ile105 allele protect against Parkinson's disease and schizophrenia in Han Chinese.
24835231 The polymorphisms of HNMT and HRH3 were irrelevant with breast cancer in the present study.
23932992 The A939G HNMT polymorphism is associated with autoimmune MG, while no association with C314T SNP was found.
21794955 The results of this study indicated that Histamine N-methyltransferase Thr105Ile polymorphism is associated Parkinson's disease.
21138759 Lack of the association of HNMT Thr105Ile functional polymorphism with Alzheimer's disease is found.
21040557 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20551163 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19773194 This study do not support the HNMT Thr105Ile variant as a factor in disease development or a genetic link between the disorders.
19773194 Observational study of gene-disease association. (HuGE Navigator)
19538200 our results suggest that, despite the possible role of histamine in the inflammatory processes related with the pathogenesis of MS, HNMT polymorphism is not related with the risk for MS in Caucasian Spanish people
19538200 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19178400 The HNMT 939A>G polymorphism lowers HNMT enzymatic activity by decreasing HNMT mRNA stability, which leads to an increase in the histamine level and contributes to the development of aspirin intolerant chronic urticaria.
19178400 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19025430 Increased histamine levels in patients with atopic dermatitis may result, at least in part, from reduced enzymatic inactivation via HNMT.
19025430 Observational study of gene-disease association. (HuGE Navigator)
18543121 These results, combined with previous findings indicating alterations in the frequency for the HNMT Thr105Ile polymorphism in patients with PD, suggest that alterations of histamine homeostasis in the SNC are associated with risk of movement disorders.
18543121 Observational study of gene-disease association. (HuGE Navigator)
18266724 histamine N-methyltransferase is not related with the risk for migraine.
18266724 Observational study of gene-disease association. (HuGE Navigator)
18254975 Observational study of gene-disease association. (HuGE Navigator)
18154359 Molecular dynamics simulations indicate that the histamine N-methyltransferase T105I polymorphism affects both active site structure and dynamics.
18086566 No association can be found in the involvement of HNMT C314T polymorphism in the susceptibility to duodenal ulcer
18086566 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17985251 An association of the HNMT Thr105Ile polymorphism, but not of the ABP1 His645Asp polymorphism, with PD was observed. Patients with PD showed a higher frequency of homozygous HNMT genotypes
17985251 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17651147 Observational study of gene-disease association. (HuGE Navigator)
16950574 Observational study of gene-disease association. (HuGE Navigator)
16669609 Observational study of gene-disease association. (HuGE Navigator)
16554448 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16489678 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16205835 Observational study of gene-disease association. (HuGE Navigator)
16205835 Polymorphisms and haplotypes in the the HNMT gene are not associated with asthma in the Indian population.
15953854 Observational study of gene-disease association. (HuGE Navigator)
15770103 Observational study of gene-disease association. (HuGE Navigator)
15693910 Observational study of gene-disease association. (HuGE Navigator)
15551002 Observational study of gene-disease association. (HuGE Navigator)
15551002 no evidence for the involvement of HNMT polymorphisms in the susceptibility to gastric ulcer
14667820 Studies showed a new brain HNMT mRNA species, named HNMT-Short (HNMT-S), which encodes a 126-amino-acid protein.
12867290 Observational study of gene-disease association. (HuGE Navigator)
12867290 the C314T polymorphism was functionally important and contributes in part to phenotypic variance of histamine N-methyltransferase activity in Chinese Han population
12835614 Observational study of gene-disease association. (HuGE Navigator)
12835614 Single nucleotide polymorphisms were identified in HNMT in Chinese and their relationship assessed with its activity.
12755416 for the histamine N-methyltransferase gene no differences in allele distribution were found in patients with food allergy and sprue compared to controls except for the 314t allele
12417108 Observational study of genotype prevalence. (HuGE Navigator)
12167489 Observational study of genotype prevalence. (HuGE Navigator)
12167489 identification of several novel HNMT polymorphisms, identification of the HNMT core promoter

AA Sequence

MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQI      1 - 70
LSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIH     71 - 140
MIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDN    141 - 210
LGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVL    211 - 280
FNNTLSFIVIEA                                                              281 - 292
//

Text Mined References (61)

PMID Year Title
26206890 2015 Mutations in the histamine N-methyltransferase gene, HNMT, are associated with nonsyndromic autosomal recessive intellectual disability.
25909280 2015 Genetic Variation along the Histamine Pathway in Children with Allergic versus Nonallergic Asthma.
25768024 2015 Association of histamine N-methyltransferase Thr105Ile polymorphism with Parkinson's disease and schizophrenia in Han Chinese: a case-control study.
24835231 2014 Associations of polymorphisms in histidine decarboxylase, histamine N-methyltransferase and histamine receptor H3 genes with breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23932992 2013 Association of myasthenia gravis with polymorphisms in the gene of histamine N-methyltransferase.
21794955 2012 Histamine N-methyltransferase Thr105Ile polymorphism is associated with Parkinson's disease.
21269460 2011 Initial characterization of the human central proteome.
21138759 2011 No association between histamine N-methyltransferase functional polymorphism Thr105Ile and Alzheimer's disease.
21040557 2010 Polymorphisms of two histamine-metabolizing enzymes genes and childhood allergic asthma: a case control study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20551163 2010 The role of histamine degradation gene polymorphisms in moderating the effects of food additives on children's ADHD symptoms.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19773194 2010 Histamine N-methyltransferase Thr105Ile is not associated with Parkinson's disease or essential tremor.
19538200 2010 Histamine-N-methyl transferase polymorphism and risk for multiple sclerosis.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19178400 2009 Histamine N-methyltransferase 939A>G polymorphism affects mRNA stability in patients with acetylsalicylic acid-intolerant chronic urticaria.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19025430 2008 Association of the histamine N-methyltransferase C314T (Thr105Ile) polymorphism with atopic dermatitis in Caucasian children.
18543121 2008 The nonsynonymous Thr105Ile polymorphism of the histamine N-methyltransferase is associated to the risk of developing essential tremor.
18266724 2008 Histamine-N-methyl transferase polymorphism and risk for migraine.
18254975 2008 Physiogenomic comparison of human fat loss in response to diets restrictive of carbohydrate or fat.
18154359 2008 The histamine N-methyltransferase T105I polymorphism affects active site structure and dynamics.
18086566 2008 C314T polymorphism in histamine N-methyltransferase gene and susceptibility to duodenal ulcer in Chinese population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17985251 2008 Nonsynonymous polymorphisms of histamine-metabolising enzymes in patients with Parkinson's disease.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17651147 2007 Polymorphisms of histamine-metabolizing enzymes and clinical manifestations of asthma and allergic rhinitis.
16950574 2007 Association of THR105Ile, a functional polymorphism of histamine N-methyltransferase (HNMT), with alcoholism in German Caucasians.
16669609 2006 Endogenous histamine and cortisol levels in subjects with different histamine N-methyltransferase C314T genotypes : a pilot study.
16554448 2006 Altered methylprednisolone pharmacodynamics in healthy subjects with histamine N-methyltransferase C314T genetic polymorphism.
16489678 2006 Severity of ulcerative colitis is associated with a polymorphism at diamine oxidase gene but not at histamine N-methyltransferase gene.
16205835 2005 Lack of association of histamine-N-methyltransferase (HNMT) polymorphisms with asthma in the Indian population.
15953854 2005 Polymorphisms of high-affinity IgE receptor and histamine-related genes in patients with ASA-induced urticaria/angioedema.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15770103 2005 Thr105Ile, a functional polymorphism of histamine N-methyltransferase, is associated with alcoholism in two independent populations.
15693910 2005 No association of histamine- N-methyltransferase polymorphism with asthma or bronchial hyperresponsiveness in two German pediatric populations.
15551002 2004 Single nucleotide polymorphisms and haplotypes of histamine N-methyltransferase in patients with gastric ulcer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667820 2004 Characterization of a new mRNA species from the human histamine N-methyltransferase gene.
12867290 2003 Genotype-phenotype correlation for histamine N-methyltransferase in a Chinese Han population.
12835614 2003 Histamine N-methyltransferase gene polymorphisms in Chinese and their relationship with enzyme activity in erythrocytes.
12755416 2003 Analysis of genetic polymorphisms of enzymes involved in histamine metabolism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417108 2002 Analysis of the C314T and A595G mutations in histamine N-methyltransferase gene in a Chinese population.
12358773 2002 Membrane-bound histamine N-methyltransferase in mouse brain: possible role in the synaptic inactivation of neuronal histamine.
12167489 2002 Human histamine N-methyltransferase pharmacogenetics: gene resequencing, promoter characterization, and functional studies of a common 5'-flanking region single nucleotide polymorphism (SNP).
11566133 2001 Two polymorphic forms of human histamine methyltransferase: structural, thermal, and kinetic comparisons.
10803682 2000 Histamine N-methyltransferase pharmacogenetics: association of a common functional polymorphism with asthma.
9547362 1998 Human histamine N-methyltransferase pharmacogenetics: common genetic polymorphisms that alter activity.
8605025 1996 Human histamine N-methyltransferase gene: structural characterization and chromosomal location.
8145732 1994 Human histamine N-methyltransferase pharmacogenetics: cloning and expression of kidney cDNA.
7943261 1994 Structure and function of human histamine N-methyltransferase: critical enzyme in histamine metabolism in airway.