Property Summary

NCBI Gene PubMed Count 201
PubMed Score 381.86
PubTator Score 385.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Gene RIF (190)

PMID Text
26945423 Early-stage ovarian clear cell carcinoma tended to have high levels of HNF-1beta immunoreactivity. Low-level HNF-1beta expression was observed in patients with recurrence and high-level HNF-1beta was associated with good prognosis.
26339401 Combining HNF-1beta and napsin A may distinguish clear cell carcinoma from high-grade serous carcinoma, endometrioid adenocarcinoma and metastatic Krukenberg tumors.
26329304 The binding of has-miRNAs 214-5p and 550a-5p regulate the expression of the HNF1B gene and the susceptibility of type 2 diabetes mellitus.
26311117 HNF-1B-positive malignant cells could be bipotential cells and give rise to both hepatocytic and cholangiocytic lineages during tumorigenesis.
26214421 Meta-analysis of the association between the HNF1B rs4430796 (A>G) polymorphism and risk of prostate cancer based on case-control studies.
26030369 Studied upstream and downstream regulatory factors of HNF-1beta in ovarian clear cell carcinomas.
26022541 HNF1B score was discriminatory for HNF1B mutations in a large cohort of individuals tested in a single UK centre
25885815 rs4430796 polymorphism of HNF1B gene influences independently the prognosis of EC patients with a potential effect on tumor chemo-sensitivity.
25884453 In cervical carcinoma, expression of HNF-1beta is mostly restricted to adenocarcinomas and can be used as an auxiliary adenocarcinoma marker in the differential diagnosis of poorly differentiated cervical carcinomas.
25741167 Case Report: severe hepatic phenotype of an HNF1B variant.
25638216 Hepatocyte nuclear factor 1beta (HNF1beta) is a transcription factor that is essential for the embryogenesis and development of the kidney, pancreas and liver.
25551297 In diagnosis of ovarian clear cell carcinoma, HNF1beta is highly sensitive but is suboptimally specific in isolation.
25536396 Heterozygous mutations in the coding region or splice sites of HNF1B, and complete gene deletion, each account for approximately 50% of all cases of HNF1B-associated disease, respectively, and often arise spontaneously
25500806 HNF1B mutations are responsible for approximately 10% of cases of congenital abnormalities of kidney and urinary tract, both in children and in adults
25441779 study of six HNF1B gene (MODY5) variations including two heterozygous whole gene deletions in 50 unrelated Indian subjects with young onset diabetes
25378557 Our findings provide evidence for a single signal associated with endometrial cancer risk at the HNF1B locus, and that risk is likely mediated via altered HNF1B gene expression.
25367728 A mutation in HNF-1B that encoded methionine to valine amino acid change was identified in a family with maturity-onset diabetes of the young type 5.
25324567 Complete deletion of the HNF1B gene and 17q12 microdeletion syndrome are actually the same genetic disorder
25256560 Duodenal atresia in 17q12 microdeletion including HNF1B; it is hypothesized that HNF1B may play a role in intestinal differentiation and development.
25177939 Studies show a significant association between the hepatocyte nuclear factor 1beta (HNF1beta) rs4430796 polymorphism and prostate cancer risk, although the degree of this association and frequency of the causative allele varied among men of different races.
25052070 Our results indicated that HNF1beta expression is a crucial predictor of poor prognosis in HCC and is independent of tumor stage.
24968817 Results indicated that the downregulation of HNF1B may contribute to drug resistance in ovarian cancer, through various pathways.
24897035 HNF1B score is a simple and accurate tool to provide a more rational approach to select patients for HNF1B screening.
24804869 High HNF1B expression is associated with clear cell carcinoma of ovarian cancer.
24698406 Variations in HNF1B gene is associated with Maturity-Onset Diabetes of the Young.
24387224 Mutations of HNF1B could explain chronic kidney disease in up to 9% of adult patients with a nephropathy of unknown aetiology.
24332637 High HNF1B expression is associated with prostate cancer.
24254850 Here we report two fetal siblings and their father who have a HNF1B missense mutation and describe the fetal phenotype associated with mutation in this gene
24204001 PCBD1 is coactivator of the HNF1B-mediated transcription necessary for fine tuning FXYD2 transcription in the distal convoluted tubule.
24119877 While HNF1B disease was still unknown one decade ago, it has emerged as the second most prevalent dominantly inherited kidney disease. Data available pave the way for early recognition and improved specific management, including genetic counselling.
24105991 Data show that HNF-1b functionally plays an important role in the unique biology of ovarian clear cell carcinoma from multiple point of view including cell proliferation, glucose metabolism and gene expressions.
24103020 similarly to the situation for the ovary, a diagnostic panel of HNF-1beta and ER may be considered for separating clear cell carcinoma from endometrioid and serous carcinoma of the endometrium
24071869 HNF-1beta seems to be a sensitive and specific marker for ovarian clear cell carcinoma and is not expressed in high-grade serous carcinoma with clear cell change.
24040285 HNF1B is a broad marker of clear cell phenotype which is linked to glycogen accumulation and thrombosis in clear cell carcinoma patients.
23979948 Our data demonstrate that HNF1beta is a novel repressor of human PTH gene transcription, which could contribute to the development of hyperparathyroidism in patients with HNF1beta mutations or deletions.
23725647 Hepatocyte nuclear factor 1beta is a member of the homeodomain-containing super family of transcription factors, and is known to regulate tissue-specific gene expression in the kidney.
23704921 Hypoxia induced early up-regulation of Hnf-1beta from 1 to 24 hours, independently of the hypoxia-inducible factor Hif-1alpha.
23539225 REport high rate of mutations in HNF1B genes known to be involved in monogenic syndromic Congenital anomalies of the kidney and urinary tract.
23535649 Different variants in HNF1B associate with risk of serous and clear cell epithelial ovarian cancer; DNA methylation and expression patterns are also notably distinct between these subtypes
23300827 Our findings suggested that TCF2 variants may be involved in type 2 diabetes risk in a Han population of northeastern China.
23237209 Hepatocyte nuclear factor-1beta is underexpressed in chromophobe renal cell carcinoma.
23203386 Immunohistological detection of HNF1beta predicts recurrence and HCC-specific death after liver transplantation and provides an additive benefit in comparison with the Milan selection criteria on their own.
23193118 No evidence that diabetes mediates the association of the HNF1B locus with prostate cancer risk from a mediation analysis of 9,065 prostate cancer cases and 9,526 controls.
22747504 The diagnosis of ovarian carcinomas with clear cells can be made with greater accuracy by using the intensity and extent of immunoreactivity for HNF-1beta.
22730461 NUDT11, HNF1B, and SLC22A3 genes have roles in prostate cancer pathogenesis
22641569 We demonstrated that a novel HNF-1beta mutation strongly influences the expression of both polycystic kidney disease 2 and suppressor of cytokine signaling 3.
22591187 HNF-1beta in endometriosis might be a factor that controls the cell cycle and DNA damage checkpoints. [review]
22587559 Results show that mutations of HN1b account for 15 of cases of MODY and a rare cause of diabetes in the known renal disease
22495362 greatest diagnostic utility of HNF1beta expression may be in a supportive evidentiary role favoring clear cell carcinoma when the principal differential diagnostic consideration is endometrioid carcinoma
22299039 HNF1B SNPs are associated with risk of endometrial cancer and the associated relative risks are similar for Type I and Type II tumors.
22269832 As compared to controls, no difference was observed in the urinary mRNA amount of HNF1B and the renal cystic genes
22160269 role of HNF1alpha/beta in the transcriptional regulation of organic anion transporters and highlighted DNA methylation-dependent gene silencing as one of the mechanisms underlying the tissue-specific transactivation by this master regulator.
22114815 One genomic HNF1beta mutation was detected in 3% of patients with prune belly syndrome but found to be functionally normal. Thus, functionally significant HNF1beta mutations are uncommon in prune belly syndrome, despite case reports of HNF1beta deletions
22060211 In Japanese patients with pediatric-onset MODY-type diabetes, mutations in known genes were identified at a much higher frequency than previously reported for adult Asians.
22051731 Patients with the HNF-1beta mutation in Chinese diabetic patients with renal dysfunction can have different pancreatic and extrapancreatic phenotypes.
22034641 We describe severely affected patients with polycystic kidney disease who carry, in addition to their expected familial germ-line defect, additional mutations in PKD genes, including HNF-1beta, which likely aggravate the phenotype.
21982019 HNF1B may have a role in prostate cancer in the Korean population
21775974 clinical presentation, imaging findings, genetic changes, and disease progression in 27 adults from 20 families with HNF1B nephropathy. Whole-gene deletion was found in 11 families, point mutations in 9, and de novo mutations in half of the kindred tested
21576123 This study demonstrates a complex relationship between variants in the HNF1B region and prostate cancer risk.
21499250 identified an endometrial cancer susceptibility locus close to HNF1B at 17q12 (rs4430796, P = 7.1 x 10(-10)) that is also associated with risk of prostate cancer and is inversely associated with risk of type 2 diabetes
21496868 HNF-1beta is a useful marker in differentiating clear cell adenocarcinoma of the bladder/ urethra from invasive urothelial carcinomas or other types of bladder adenocarcinomas and to a lesser extent from nephroogenic adenoma.
21438902 There is a role of HNF1B in association with the high frequency of chromosome 17q duplication in the development of papillary renal cell tumours and mucinous tubular and spindle cell carcinomas as well as in their precursor lesions.
21380624 Mutations in HNF1Beta and PAX2 commonly cause syndromic urinary tract malformation.
21163139 The detection rate of TCF2 anomalies was 9.7% and varied considerably among MODY (1.4%), renal structure anomalies (RSA) (21.4%) and RSA with MODY (41.2%) subgroups.
21130072 wild type HNF1B specifically induces FXYD2A transcription whereas all HNF1B mutants partially prevented it.
21071540 Observational study of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20878950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20717903 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20690139 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20668890 HNF1b-expressing cells could differentiate to all the types of pancreatic cells during embryonic days (e) 11.5-13.5, to endocrine and duct cells during e13.5-16.5, and only to duct cells at postnatal to adult stages.
20633866 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20590552 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20543213 Mutations in HNF1 beta is associated with development of Growth hormone therapy-related hyperglycaemia in renal cystic hypodysplasia.
20538322 The level of HNF-1B mRNA expression significantly decreases with tumor progression, and patients with high HNF-1B mRNA levels have a significantly better prognosis
20526366 The examined HNF1B variants have a highly specific effect on prostate cancer risk with no apparent association with any of the other studied cancer types.
20526366 Meta-analysis of gene-disease association. (HuGE Navigator)
20460480 Observational study of gene-disease association. (HuGE Navigator)
20450899 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378641 The severity of the renal disease associated with HNF1B mutations was extremely variable (from prenatal renal failure to normal renal function in adulthood) and was not correlated with the genotype.
20378641 Observational study of gene-disease association. (HuGE Navigator)
20215779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20161779 Observational study of gene-disease association. (HuGE Navigator)
20155289 We identified HNF1B alterations in 5 out of 50 patients renal hypodysplasia, unilateral multicystic dysplastic kidney, and other congenital anomalies of the kidney and urinary tract
20155289 Observational study of gene-disease association. (HuGE Navigator)
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
20026053 Observational study of gene-disease association. (HuGE Navigator)
20025686 Hepatocyte nuclear factor-1beta frame-shift mutation in sporadic glomerulocystic kidney disease associated with agenesis of the corpus callosum.
19998368 HNF1B variants are directly associated with both diabetes and prostate cancer, that diabetes does not mediate these gene variant-prostate cancer relationships, and the relationship between these diseases is not mediated through these gene variants.
19998368 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19959718 Observational study of gene-disease association. (HuGE Navigator)
19924231 analysis of isoform-specific expression of the human, mouse and rat HNF1A, HNF1B and HNF4A genes
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902474 Observational study of gene-disease association. (HuGE Navigator)
19900942 Observational study of gene-disease association. (HuGE Navigator)
19866473 Observational study of gene-disease association. (HuGE Navigator)
19833888 Observational study of gene-disease association. (HuGE Navigator)
19760597 we summarize HNF-1beta expression in the developing urogenital system of the human embryo describe the HNF-1beta status in human urogenital neoplasms and discuss its role in tumorigenesis
19741195 HNF-1alpha and/or HNF-1beta binding is required for SVCT1 expression
19627283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19549807 Observational study of gene-disease association. (HuGE Navigator)
19487294 vHNF1 acts as a repressor of HSulf-1 expression and might be a molecular target for ovarian cancer therapy.
19423541 Observational study of gene-disease association. (HuGE Navigator)
19417042 The clinical data of our cases enlarge the wide spectrum of patients with HNF1B anomaly.
19389850 a role for HNF1B not only in nephrogenesis but also in the maintenance of tubular function
19389850 Observational study of gene-disease association. (HuGE Navigator)
19366831 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19361964 In conclusion, TCF2 molecular anomalies are involved in restricted renal phenotype in childhood without alteration of glucose metabolism.
19346182 Phenotypic heterogeneity of this gene's mutations acount for kidney and other abnormalities, and type 2 diabetes in a family.
19324937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19320191 HNF-1beta is involved in the development of mesonephric duct derivatives and metanephros. HNF-1beta expression is conserved in the mesonephric duct remnants throughout life.
19318432 Observational study of gene-disease association. (HuGE Navigator)
19247372 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19228875 Observational study of gene-disease association. (HuGE Navigator)
19168595 Variants in the HNF1beta region contribute to susceptibility to type 2 diabetes in the Chinese population.
19168595 Observational study of gene-disease association. (HuGE Navigator)
18811724 Observational study of gene-disease association. (HuGE Navigator)
18794092 Observational study of gene-disease association. (HuGE Navigator)
18758462 Single nucleotide polymorphism in HNF1B gene is associated with prostate cancer.
18758462 Observational study of gene-disease association. (HuGE Navigator)
18644064 agenesis of the pancreatic body & tail and pancreatic exocrine dysfunction are parts of the phenotype in HNF1B mutation carriers; this strengthens the evidence for a critical role of HNF1B in development and differentiation of at least the dorsal pancreas
18536653 Hepatocyte nuclear factor-1beta is a useful marker to identify these clear cell pancreatic carcinomas.
18509286 current literature is reviewed concerning the malformations that have been associated with transcription factor 2 gene mutations involving primarily the kidneys and occurring both in an isolated form and in association with other defective organs [review]
18426861 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18418350 Theses studies show novel proteins may cooperate with HNF1beta in human metanephric development and propose that E4F1 and ZFP36L1 are congenital anomalies of the kidney and urinary tract genes.
18399756 Three anaplastic papillary thyroid cancer cell lines expressed HNF-1beta.
18393978 HNF-1beta is likely to participate in osteopontin up-regulation in clear cell carcinoma .
18332101 Observational study of gene-disease association. (HuGE Navigator)
18264096 Genome-wide association study of gene-disease association. (HuGE Navigator)
18066692 Hypomethylation of the HNF-1beta CpG island participates in the HNF-1beta up-regulation in ovarian clear cell carcinoma.
18065799 results indicate that mutations in EYA1 and TCF2 rarely result in an isolated Congenital anomalies of the kidney and urinary tract (CAKUT) phenotype.
18037103 Bilateral massively enlarged polycystic kidneys mimicking autosomal dominant polycystic kidney disease in young adults may be related to TCF2/HNF-1beta mutation.
17971380 Whole HNF-1beta gene deletions are a common cause of developmental renal disease, particularly renal cystic
17928287 the up-regulation of TCF11/MafG binding could be suppressed by overexpression of the TGF-beta inhibitor Smad7, and a small interfering RNA to TCF11 blocked the suppression of iNOS by TGF-beta.
17924661 help us to understand the structural basis of promoter recognition by these atypical POU transcription factors and the site-specific functional disruption by disease-causing mutations
17923767 Findings implicate HNF1beta as a regulator of pancreas organogenesis and differentiation. [REVIEW]
17922147 no direct relationship between horseshoe kidney in TS and mutation or polymorphism of HNF-1beta gene, but we speculate that target gene(s) of HNF-1beta, likely mapped on the X chromosome, is/are responsible of the horseshoe kidney formation in TS.
17878605 R276X functions in a negative manner in regard to metabolic responses of insulin secretion in beta cells.
17603485 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17603485 Two variants on chromosome 17q contribute to the risk of prostate cancer in 4 populations, one of the variants is in TCF2 confers protection against type 2 diabetes.
17503391 TCF2 is a biological tumor marker for epithelial ovarian cancers.
17327436 Observational study of gene-disease association. (HuGE Navigator)
17327436 A study evaluating the extent to which common variation in the six known maturity-onset diabetes of the young (MODY) genes, which cause a monogenic form of type 2 diabetes, is associated with type 2 diabetes is presented.
17267738 Heterozygous deletion of the TCF2 gene is an important cause of fetal hyperechogenic kidneys in this study and showed to be linked with early disease expression.
17116179 a key role for HNF-1beta in early pancreatic progenitor cells in man
16971658 Mutations in TCF2 is associated with renal hypodysplasia
16873704 Observational study of gene-disease association. (HuGE Navigator)
16801329 Evidence of differential gene-dosage requirements for HNF1beta in normal human kidney and pancreas differentiation.
16793932 These results indicate that the tissue-specific expression of hOAT3 might be regulated by the concerted effect of genetic (HNF1alpha and HNF1beta) and epigenetic (DNA methylation) factors.
16781669 both wild HNF-1alpha and wild HNF-1beta have a stimulatory effect on dipeptidylpeptidase IV gene expression, but that mutant HNF-1alpha and mutant HNF-1beta attenuate the stimulatory effect
16676400 depsipeptide represses NNMT and HNF-1beta gene expression in some papillary thyroid cancer cells
16562587 Observational study of genotype prevalence. (HuGE Navigator)
16562587 No mutation was identified in the HNF-1beta genes in Japanese patients with juvenile-onset (before 18 years of age) non-obese diabetes mellitus.
16479257 results suggest that TCF2 is involved in the development of ovarian cancers and may represent a useful target for their detection and treatment
16443774 Subjects with HNF-1beta mutations have reduced insulin sensitivity of endogenous glucose production but normal peripheral insulin sensitivity in contrast to patients with HNF-1alpha mutations and normal controls.
16297991 we propose that HNF1beta overexpression in the ovarian cancer participates in the altered expression pattern
16258507 Results indicate that HNF-1beta is an excellent molecular marker for ovarian clear cell tumors.
16249435 Observational study of genetic testing. (HuGE Navigator)
16249435 In 40 unrelated patients presenting with MODY5 phenotype, TCF2 was screened for mutations by sequencing.
15961790 transcription factors hepatic nuclear factor 1 (HNF1)alpha and beta play an important part in the regulation of the ACAT2 promoter
15660195 HNF-1beta gene mutations may be associated with nondiabetic renal dysfunction and diabetes in Chinese, but they are responsible for only a small percentage of early onset or multiple affected diabetes pedigrees including MODY.
15647252 the hepatocyte nuclear factor-1beta (HNF-1beta) C-terminal domain has a role in Pkhd1 (ARPKD) gene transcription and renal cystogenesis
15522234 These results suggest that sucrase-isomaltase transcription might be unchanged or lower in maturity-onset diabetes of the young (MODY) type 3, but greater in MODY5.
15486044 HNF-1beta functions as a transcription activator for NNMT gene expression in some papillary thyroid cancer cells
15355349 HNF1B has several domains involved in nephrogenesis and partially rescues Pax8/lim1-induced kidney malformations.
15111528 diabetes phenotype due to HNF-1beta mutations is similar to that in HNF-1alpha
15067324 Altered mRNA expression is associated with prostate cancer recurrence.
14633622 The reduction of HNF-1 beta expression by RNA interference induced apoptotic cell death in ovarian clear cell carcinoma cells.
14583183 Results suggest genetic variants in HNF-1beta are not a common cause of young-onset diabetes or diabetic nephropathy in Chinese, but may modify disease manifestation and progression.
12675839 Hyperuricemia and young-onset gout are consistent features of the phenotype associated with HNF-1beta mutations, but the mechanism is uncertain.
12161522 Observational study of gene-disease association. (HuGE Navigator)
12161522 Nonsense and missense mutations in the human hepatocyte nuclear factor-1 beta gene (TCF2) and their relation to type 2 diabetes in Japanese.
12148114 Renal cysts and diabetes syndrome with nonprogressive liver disorder are linked to mutations of the hepatocyte nuclear factor-1 beta gene.
12012276 results confirm that the genetic variations in the HNF-1 beta gene would be a very uncommon cause of progressive nephropathy in patients with type 2 diabetes mellitus
11918730 Solitary functioning kidney and diverse genital tract malformations associated with HNF-1beta mutations
11880302 Cell-specific involvement of HNF-1beta in alpha(1)-antitrypsin gene expression in human respiratory epithelial cells.
11845238 Identification of a gain-of-function mutation in the HNF-1beta gene in a Japanese family with MODY
11845237 an Italian family in which a syndrome of diabetes and severe non-diabetic renal disease is associated with a mutation in the HNF-1Beta gene
11716293 Observational study of gene-disease association. (HuGE Navigator)
11668623 Observational study of gene-disease association. (HuGE Navigator)
11668623 variants of the hepatocyte nuclear factor-1beta (HNF-1beta / TCF2) and the dimerization cofactor of HNF-1 (DcoH/PCBD) genes in relation to type 2 diabetes mellitus and beta-cell function
11206404 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHA      1 - 70
KGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVV     71 - 140
DVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFS    141 - 210
QQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSP    211 - 280
SKAHGLGSNLVTEVRVYNWFANRRKEEAFRQKLAMDAYSSNQTHSLNPLLSHGSPHHQPSSSPPNKLSGV    281 - 350
RYSQQGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMISVSGGGLPPVSTLTNIH    351 - 420
SLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPVINSVAGSLAALQPVQFSQQLHSPHQQPLMQQS    421 - 490
PGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSISTLTNMSSSKQCPLQAW       491 - 557
//

Text Mined References (209)

PMID Year Title
26945423 2016 Clinicopathologic Significance of HNF-1?, AIRD1A, and PIK3CA Expression in Ovarian Clear Cell Carcinoma: A Tissue Microarray Study of 130 Cases.
26339401 2015 Diagnostic value of dual detection of hepatocyte nuclear factor 1 beta (HNF-1?) and napsin A for diagnosing ovarian clear cell carcinoma.
26329304 2015 Polymorphism in microRNA-binding site in HNF1B influences the susceptibility of type 2 diabetes mellitus: a population based case-control study.
26311117 2015 Overexpression Of Hepatocyte Nuclear Factor-1beta Predicting Poor Prognosis Is Associated With Biliary Phenotype In Patients With Hepatocellular Carcinoma.
26214421 2015 Meta-analysis of the association between the HNF1B rs4430796 (A>G) polymorphism and risk of prostate cancer based on case-control studies.
26030369 2015 Transcriptional upregulation of HNF-1? by NF-?B in ovarian clear cell carcinoma modulates susceptibility to apoptosis through alteration in bcl-2 expression.
26022541 2015 Assessment of the HNF1B Score as a Tool to Select Patients for HNF1B Genetic Testing.
25885815 2015 HNF1B polymorphism influences the prognosis of endometrial cancer patients: a cohort study.
25884453 2015 Expression of HNF-1? in cervical carcinomas: an immunohistochemical study of 155 cases.
25741167 2015 Hepatic phenotypes of HNF1B gene mutations: a case of neonatal cholestasis requiring portoenterostomy and literature review.
25638216 2015 Renal involvement in children with HNF1? mutation: early sonographic appearances and long-term follow-up.
25551297 2015 Comparative analysis of Napsin A, alpha-methylacyl-coenzyme A racemase (AMACR, P504S), and hepatocyte nuclear factor 1 beta as diagnostic markers of ovarian clear cell carcinoma: an immunohistochemical study of 279 ovarian tumours.
25536396 2015 HNF1B-associated renal and extra-renal disease-an expanding clinical spectrum.
25500806 2015 Criteria for HNF1B analysis in patients with congenital abnormalities of kidney and urinary tract.
25441779 2015 Identification and molecular characterization of HNF1B gene mutations in Indian diabetic patients with renal abnormalities.
25378557 2015 Fine-mapping of the HNF1B multicancer locus identifies candidate variants that mediate endometrial cancer risk.
25367728 2014 Maturity-onset diabetes of the young type 5 in a family with diabetes and mild kidney disease diagnosed by whole exome sequencing.
25324567 2015 Towards a new point of view on the phenotype of patients with a 17q12 microdeletion syndrome.
25256560 2014 Duodenal atresia in 17q12 microdeletion including HNF1B: a new associated malformation in this syndrome.
25177939 2014 Racial disparities in the association between diabetes mellitus-associated polymorphic locus rs4430796 of the HNF1? gene and prostate cancer: a systematic review and meta-analysis.
25052070 2014 Expression of bile duct transcription factor HNF1? predicts early tumor recurrence and is a stage-independent prognostic factor in hepatocellular carcinoma.
24968817 2014 Downregulation of HNF1 homeobox B is associated with drug resistance in ovarian cancer.
24953961 2014 Effects of palmitate on genome-wide mRNA expression and DNA methylation patterns in human pancreatic islets.
24897035 2014 The HNF1B score is a simple tool to select patients for HNF1B gene analysis.
24804869 2014 Inhibition of cell death and induction of G2 arrest accumulation in human ovarian clear cells by HNF-1? transcription factor: chemosensitivity is regulated by checkpoint kinase CHK1.
24740154 2014 Genome-wide association scan for variants associated with early-onset prostate cancer.
24698406 2014 Lessons from whole-exome sequencing in MODYX families.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24387224 2014 Chronic renal failure of unknown origin is caused by HNF1B mutations in 9% of adult patients: a single centre cohort analysis.
24332637 2014 Expression patterns of candidate susceptibility genes HNF1? and CtBP2 in prostate cancer: association with tumor progression.
24254850 2013 A description of a fetal syndrome associated with HNF1B mutation and a wide intrafamilial disease variability.
24204001 2014 Mutations in PCBD1 cause hypomagnesemia and renal magnesium wasting.
24119877 2013 [HNF1B-related disease: paradigm of a developmental gene and unexpected recognition of a new renal disease].
24105991 2015 Hepatocyte nuclear factor-1? (HNF-1?) promotes glucose uptake and glycolytic activity in ovarian clear cell carcinoma.
24103020 2014 Immunohistochemical characterization of prototypical endometrial clear cell carcinoma--diagnostic utility of HNF-1? and oestrogen receptor.
24071869 2013 HNF-1? in ovarian carcinomas with serous and clear cell change.
24040285 2013 Integrative bioinformatics links HNF1B with clear cell carcinoma and tumor-associated thrombosis.
23979948 2013 Early development of hyperparathyroidism due to loss of PTH transcriptional repression in patients with HNF1? mutations?
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23725647 2013 Different phenotypes of HNF1ß deletion mutants in familial multicystic dysplastic kidneys.
23704921 2013 Hnf-1? transcription factor is an early hif-1?-independent marker of epithelial hypoxia and controls renal repair.
23539225 2013 Severe prenatal renal anomalies associated with mutations in HNF1B or PAX2 genes.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23535649 2013 Epigenetic analysis leads to identification of HNF1B as a subtype-specific susceptibility gene for ovarian cancer.
23300827 2012 Association of single nucleotide polymorphisms in TCF2 with type 2 diabetes susceptibility in a Han Chinese population.
23237209 2013 Underexpression of hepatocyte nuclear factor-1? in chromophobe renal cell carcinoma.
23203386 2013 Hepatocyte nuclear factor 1? is a novel prognostic marker independent of the Milan criteria in transplantable hepatocellular carcinoma: a retrospective analysis based on tissue microarrays.
23193118 2012 Association of type 2 diabetes susceptibility variants with advanced prostate cancer risk in the Breast and Prostate Cancer Cohort Consortium.
22961080 2013 A genome-wide association study identifies GRK5 and RASGRP1 as type 2 diabetes loci in Chinese Hans.
22747504 2012 Utility of hepatocyte nuclear factor-1? as a diagnostic marker in ovarian carcinomas with clear cells.
22730461 2012 Genetic and functional analyses implicate the NUDT11, HNF1B, and SLC22A3 genes in prostate cancer pathogenesis.
22641569 HNF-1? mutation affects PKD2 and SOCS3 expression causing renal cysts and diabetes in MODY5 kindred.
22591187 2012 A potential link of oxidative stress and cell cycle regulation for development of endometriosis.
22587559 2013 HNF1B deletions in patients with young-onset diabetes but no known renal disease.
22495362 2012 Diagnostic utility of hepatocyte nuclear factor 1-beta immunoreactivity in endometrial carcinomas: lack of specificity for endometrial clear cell carcinoma.
22299039 2012 HNF1B and endometrial cancer risk: results from the PAGE study.
22269832 2012 Expression of renal cystic genes in patients with HNF1B mutations.
22160269 2012 Regulation of tissue-specific expression of renal organic anion transporters by hepatocyte nuclear factor 1 ?/? and DNA methylation.
22114815 2012 Genetic basis of prune belly syndrome: screening for HNF1? gene.
22060211 2012 Comprehensive molecular analysis of Japanese patients with pediatric-onset MODY-type diabetes mellitus.
22051731 2012 Phenotypic heterogeneity in Chinese patients with hepatocyte nuclear factor-1? mutations.
22034641 2011 Mutations in multiple PKD genes may explain early and severe polycystic kidney disease.
21982019 2011 HNF1B polymorphism associated with development of prostate cancer in Korean patients.
21775974 2011 Diagnosis, management, and prognosis of HNF1B nephropathy in adulthood.
21743057 2011 Genome-wide association study identifies new prostate cancer susceptibility loci.
21576123 2011 Large-scale fine mapping of the HNF1B locus and prostate cancer risk.
21499250 2011 Genome-wide association study identifies a common variant associated with risk of endometrial cancer.
21496868 2011 Hepatocyte nuclear factor-1? expression in clear cell adenocarcinomas of the bladder and urethra: diagnostic utility and implications for histogenesis.
21438902 2011 Genomic profiling of papillary renal cell tumours identifies small regions of DNA alterations: a possible role of HNF1B in tumour development.
21380624 2011 HNF1B and PAX2 mutations are a common cause of renal hypodysplasia in the CKiD cohort.
21281489 2011 The nephrogenic potential of the transcription factors osr1, osr2, hnf1b, lhx1 and pax8 assessed in Xenopus animal caps.
21163139 2010 Systematic review of TCF2 anomalies in renal cysts and diabetes syndrome/maturity onset diabetes of the young type 5.
21160077 2010 Genetic correction of PSA values using sequence variants associated with PSA levels.
21130072 2011 HNF-1B specifically regulates the transcription of the ?a-subunit of the Na+/K+-ATPase.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20878950 2011 Inherited genetic markers discovered to date are able to identify a significant number of men at considerably elevated risk for prostate cancer.
20717903 2011 Evidence for an association between prostate cancer and chromosome 8q24 and 10q11 genetic variants in African American men: the Flint Men's Health Study.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20690139 2011 Meta-analysis of genome-wide and replication association studies on prostate cancer.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20676098 2010 Genome-wide association study identifies five new susceptibility loci for prostate cancer in the Japanese population.
20668890 2011 Genetic lineage tracing, a powerful tool to investigate the embryonic organogenesis and adult organ maintenance of the pancreas.
20633866 2010 Mutations in the hepatocyte nuclear factor-1? (HNF1B) gene are common with combined uterine and renal malformations but are not found with isolated uterine malformations.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20590552 2010 Number of prostate cancer risk alleles may identify possibly 'insignificant' disease.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20543213 2010 Growth hormone therapy-related hyperglycaemia in a boy with renal cystic hypodysplasia and a new mutation of the HNF1 beta gene.
20538322 2010 Downregulation of HNF-1B in renal cell carcinoma is associated with tumor progression and poor prognosis.
20526366 2010 Evaluation of association of HNF1B variants with diverse cancers: collaborative analysis of data from 19 genome-wide association studies.
20460480 2010 Susceptibility loci associated with prostate cancer progression and mortality.
20450899 2010 Individual and cumulative association of prostate cancer susceptibility variants with clinicopathologic characteristics of the disease.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378641 2010 Spectrum of HNF1B mutations in a large cohort of patients who harbor renal diseases.
20215779 2009 Evidence of interaction between type 2 diabetes susceptibility genes and dietary fat intake for adiposity and glucose homeostasis-related phenotypes.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20155289 2010 HNF1B alterations associated with congenital anomalies of the kidney and urinary tract.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
20026053 2009 WITHDRAWN: Relationships between 8q24 and 17q risk loci and sporadic or latent prostate cancer and the impacts of these loci on the clinicopathologic characteristics of prostate cancer.
20025686 2009 Hepatocyte nuclear factor-1beta frame-shift mutation in sporadic glomerulocystic kidney disease associated with agenesis of the corpus callosum.
19998368 2010 HNF1B and JAZF1 genes, diabetes, and prostate cancer risk.
19959718 2010 Whole-genome linkage and association scan in primary, nonsyndromic vesicoureteric reflux.
19924231 2009 Species-specific differences in the expression of the HNF1A, HNF1B and HNF4A genes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902474 2010 Replication of prostate cancer risk loci on 8q24, 11q13, 17q12, 19q33, and Xp11 in African Americans.
19900942 2009 Prognostic significance of prostate cancer susceptibility variants on prostate-specific antigen recurrence after radical prostatectomy.
19866473 2010 Association of 17 prostate cancer susceptibility loci with prostate cancer risk in Chinese men.
19833888 2010 Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function.
19767754 2009 Genome-wide association and replication studies identify four variants associated with prostate cancer susceptibility.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19760597 2009 Hepatocyte nuclear factor-1beta(HNF-1beta) in human urogenital organs: its expression and role in embryogenesis and tumorigenesis.
19741195 2009 Hepatocyte nuclear factor 1 is essential for transcription of sodium-dependent vitamin C transporter protein 1.
19627283 2009 Does diabetes mellitus modify the association between 17q12 risk variant and prostate cancer aggressiveness?
19549807 2009 Prostate cancer risk associated loci in African Americans.
19487294 2009 Regulation of HSulf-1 expression by variant hepatic nuclear factor 1 in ovarian cancer.
19423541 2009 Established prostate cancer susceptibility variants are not associated with disease outcome.
19417042 2009 Expanded clinical spectrum in hepatocyte nuclear factor 1b-maturity-onset diabetes of the young.
19389850 2009 HNF1B mutations associate with hypomagnesemia and renal magnesium wasting.
19366831 2009 Analysis of recently identified prostate cancer susceptibility loci in a population-based study: associations with family history and clinical features.
19361964 2009 [Abnormalities of hepatocyte nuclear factor (HNF)-1beta: biological mechanisms, phenotypes, and clinical consequences].
19346182 2009 [Phenotypic heterogeneity of TCF2's gene mutation coding for HNF-1 beta in a single family].
19324937 2009 Previously associated type 2 diabetes variants may interact with physical activity to modify the risk of impaired glucose regulation and type 2 diabetes: a study of 16,003 Swedish adults.
19320191 2009 Expression of hepatocyte nuclear factor-1beta in human urogenital tract during the embryonic stage.
19318432 2009 Generalizability of associations from prostate cancer genome-wide association studies in multiple populations.
19247372 2009 Construction of a prediction model for type 2 diabetes mellitus in the Japanese population based on 11 genes with strong evidence of the association.
19228875 2009 A-beta-subtype of ketosis-prone diabetes is not predominantly a monogenic diabetic syndrome.
19168595 2009 Common variants of hepatocyte nuclear factor 1beta are associated with type 2 diabetes in a Chinese population.
18811724 2009 Mutations of maturity-onset diabetes of the young (MODY) genes in Thais with early-onset type 2 diabetes mellitus.
18794092 2008 Association of prostate cancer risk variants with clinicopathologic characteristics of the disease.
18758462 2008 Evidence for two independent prostate cancer risk-associated loci in the HNF1B gene at 17q12.
18644064 2008 Lack of pancreatic body and tail in HNF1B mutation carriers.
18536653 2008 Clear cell carcinoma of the pancreas: histopathologic features and a unique biomarker: hepatocyte nuclear factor-1beta.
18509286 2008 TCF2 gene mutation leads to nephro-urological defects of unequal severity: an open question.
18426861 2008 Association analysis of type 2 diabetes Loci in type 1 diabetes.
18418350 2008 Transcription factor HNF1beta and novel partners affect nephrogenesis.
18399756 2008 Expression of hepatocyte nuclear factor-1alpha mRNA in human anaplastic thyroid cancer cell lines and tumors.
18393978 2008 Overexpression of osteopontin in clear cell carcinoma of the ovary: close association with HNF-1beta expression.
18332101 2008 Common variants in maturity-onset diabetes of the young genes and future risk of type 2 diabetes.
18264097 2008 Multiple newly identified loci associated with prostate cancer susceptibility.
18264096 2008 Multiple loci identified in a genome-wide association study of prostate cancer.
18212765 2008 Mechanisms of disease: genetic insights into the etiology of type 2 diabetes and obesity.
18066692 2008 Hypomethylation of hepatocyte nuclear factor-1beta (HNF-1beta) CpG island in clear cell carcinoma of the ovary.
18065799 2008 Missense mutations in EYA1 and TCF2 are a rare cause of urinary tract malformations.
18037103 2007 Massively enlarged polycystic kidneys in monozygotic twins with TCF2/HNF-1beta (hepatocyte nuclear factor-1beta) heterozygous whole-gene deletion.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17971380 2008 Hepatocyte nuclear factor-1beta gene deletions--a common cause of renal disease.
17928287 2007 Negative regulation of inducible nitric-oxide synthase expression mediated through transforming growth factor-beta-dependent modulation of transcription factor TCF11.
17924661 2007 Structural basis of disease-causing mutations in hepatocyte nuclear factor 1beta.
17923767 2007 Distinct roles of HNF1beta, HNF1alpha, and HNF4alpha in regulating pancreas development, beta-cell function and growth.
17922147 2008 Horseshoe kidney malformation in Turner syndrome is not associated with HNF-1beta gene mutations.
17878605 2007 In vitro and pathological investigations of MODY5 with the R276X-HNF1beta (TCF2) mutation.
17603485 2007 Two variants on chromosome 17 confer prostate cancer risk, and the one in TCF2 protects against type 2 diabetes.
17503391 2006 Biomarkers for epithelial ovarian cancers.
17327436 2007 Evaluation of common variants in the six known maturity-onset diabetes of the young (MODY) genes for association with type 2 diabetes.
17267738 2007 Anomalies of the TCF2 gene are the main cause of fetal bilateral hyperechogenic kidneys.
17116179 2006 Hepatocyte nuclear factor-1 beta mutations cause neonatal diabetes and intrauterine growth retardation: support for a critical role of HNF-1beta in human pancreatic development.
16971658 2006 Prevalence of mutations in renal developmental genes in children with renal hypodysplasia: results of the ESCAPE study.
16873704 2006 Association studies of variants in the genes involved in pancreatic beta-cell function in type 2 diabetes in Japanese subjects.
16801329 2006 Severe pancreas hypoplasia and multicystic renal dysplasia in two human fetuses carrying novel HNF1beta/MODY5 mutations.
16793932 2006 Regulation of the expression of human organic anion transporter 3 by hepatocyte nuclear factor 1alpha/beta and DNA methylation.
16781669 2006 Mutant HNF-1alpha and mutant HNF-1beta identified in MODY3 and MODY5 downregulate DPP-IV gene expression in Caco-2 cells.
16676400 2006 Histone deacetylase inhibitor depsipeptide represses nicotinamide N-methyltransferase and hepatocyte nuclear factor-1beta gene expression in human papillary thyroid cancer cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16562587 2006 Molecular genetic analysis of MODY candidate genes in Japanese patients with non-obese juvenile onset diabetes mellitus.
16479257 2006 Epigenetic inactivation of TCF2 in ovarian cancer and various cancer cell lines.
16443774 2006 Contrasting insulin sensitivity of endogenous glucose production rate in subjects with hepatocyte nuclear factor-1beta and -1alpha mutations.
16297991 2005 Identification of target genes of the transcription factor HNF1beta and HNF1alpha in a human embryonic kidney cell line.
16258507 2006 Expression of hepatocyte nuclear factor-1beta (HNF-1beta) in clear cell tumors and endometriosis of the ovary.
16249435 2005 Large genomic rearrangements in the hepatocyte nuclear factor-1beta (TCF2) gene are the most frequent cause of maturity-onset diabetes of the young type 5.
15961790 2005 Control of ACAT2 liver expression by HNF1.
15930087 2006 Mutations in hepatocyte nuclear factor-1beta and their related phenotypes.
15660195 2004 Scanning for MODY5 gene mutations in Chinese early onset or multiple affected diabetes pedigrees.
15647252 2005 Role of the hepatocyte nuclear factor-1beta (HNF-1beta) C-terminal domain in Pkhd1 (ARPKD) gene transcription and renal cystogenesis.
15522234 2004 Effect of mutations in HNF-1alpha and HNF-1beta on the transcriptional regulation of human sucrase-isomaltase in Caco-2 cells.
15509593 2004 HNF1beta/TCF2 mutations impair transactivation potential through altered co-regulator recruitment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486044 2005 Activation of nicotinamide N-methyltransferase gene promoter by hepatocyte nuclear factor-1beta in human papillary thyroid cancer cells.
15355349 2004 The HNF1beta transcription factor has several domains involved in nephrogenesis and partially rescues Pax8/lim1-induced kidney malformations.
15181075 2004 Neonatal diabetes mellitus and neonatal polycystic, dysplastic kidneys: Phenotypically discordant recurrence of a mutation in the hepatocyte nuclear factor-1beta gene due to germline mosaicism.
15111528 2004 Contrasting diabetes phenotypes associated with hepatocyte nuclear factor-1alpha and -1beta mutations.
15068978 2004 Clinical spectrum associated with hepatocyte nuclear factor-1beta mutations.
15067324 2004 Gene expression profiling predicts clinical outcome of prostate cancer.
15001636 2004 Promoter-specific repression of hepatocyte nuclear factor (HNF)-1 beta and HNF-1 alpha transcriptional activity by an HNF-1 beta missense mutant associated with Type 5 maturity-onset diabetes of the young with hepatic and biliary manifestations.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14633622 2003 Expression profiling in ovarian clear cell carcinoma: identification of hepatocyte nuclear factor-1 beta as a molecular marker and a possible molecular target for therapy of ovarian clear cell carcinoma.
14583183 Genetic variants of hepatocyte nuclear factor-1beta in Chinese young-onset diabetic patients with nephropathy.
12675839 2003 Atypical familial juvenile hyperuricemic nephropathy associated with a hepatocyte nuclear factor-1beta gene mutation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12161522 2002 Nonsense and missense mutations in the human hepatocyte nuclear factor-1 beta gene (TCF2) and their relation to type 2 diabetes in Japanese.
12012276 2002 Mutations and intronic variants in the HNF-1 beta gene in a group of German and Czech Caucasians with type 2 diabetes mellitus and progressive diabetic nephropathy.
11918730 2002 Solitary functioning kidney and diverse genital tract malformations associated with hepatocyte nuclear factor-1beta mutations.
11845238 2002 Identification of a gain-of-function mutation in the HNF-1beta gene in a Japanese family with MODY.
11716293 2001 Lack of association between hepatocyte nuclear factor-1beta gene and common forms of type 2 diabetes in the Japanese population.
11668623 2001 Studies of the variability of the hepatocyte nuclear factor-1beta (HNF-1beta / TCF2) and the dimerization cofactor of HNF-1 (DcoH / PCBD) genes in relation to type 2 diabetes mellitus and beta-cell function.
11206404 2001 Mutations in the hepatocyte nuclear factor-1beta (MODY5) gene are not a major factor contributing to end-stage renal disease in Japanese people with diabetes mellitus.
11085914 2001 Mutations in the hepatocyte nuclear factor-1beta gene are associated with familial hypoplastic glomerulocystic kidney disease.
10720943 2000 Abnormal nephron development associated with a frameshift mutation in the transcription factor hepatocyte nuclear factor-1 beta.
10672455 2000 Hepatocyte nuclear factor-1 beta (MODY5) gene mutations in Scandinavian families with early-onset diabetes or kidney disease or both.
10484768 1999 A novel syndrome of diabetes mellitus, renal dysfunction and genital malformation associated with a partial deletion of the pseudo-POU domain of hepatocyte nuclear factor-1beta.
9671480 1998 Role of tissue-specific transcription factor LFB3 in a cyclic AMP-responsive enhancer of the urokinase-type plasminogen activator gene in LLC-PK1 cells.
9398836 1997 Mutation in hepatocyte nuclear factor-1 beta gene (TCF2) associated with MODY.
7900999 1993 More potent transcriptional activators or a transdominant inhibitor of the HNF1 homeoprotein family are generated by alternative RNA processing.
2081590 1990 Mapping of the gene TCF2 coding for the transcription factor LFB3 to human chromosome 17 by polymerase chain reaction.
2044952 1991 HNF-1 alpha and HNF-1 beta (vHNF-1) share dimerization and homeo domains, but not activation domains, and form heterodimers in vitro.
1677179 1991 Two members of an HNF1 homeoprotein family are expressed in human liver.