Property Summary

NCBI Gene PubMed Count 379
PubMed Score 651.38
PubTator Score 726.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.093 1.1e-05

Gene RIF (332)

PMID Text
26855178 These data suggest that HNF1 plays an important role in regulating intestinal epithelial cell function, both directly and through interactions with other intestinal transcription factors.
26776850 Hepatocellular adenomas, specifically the HNF1-alpha subtype, can cause false-positive PET findings when seeking to identify malignancy.
26714756 TCF-1 expression was lower in T cells from multiple sclerosis patients compared to healthy individuals.
26549228 AES is a transcriptional repressor for HNF-1-alpha in pancreatic beta-cell.
26446475 rejected the hypothesis that all human MODY-associated mutations in HNF1A / HNF4A induce changes in the pharmacokinetics of sulfonylureas in humans analogically to the Hnf1a(-/-) mouse model
26436572 HNF-1alpha gene p379fsinsC mutation is described in a Chinese family with maturity-onset diabetes of the young type 3.
26274031 Case Report: composite focal nodular hyperplasia and hepatocellular adenoma, arising in a woman with multiple HNF1A-inactivated adenomas.
26240958 DR of any degree was not present in our GCK-MODY group, while in spite of young age almost every fourth subject with HNF1A-MODY showed signs of this complication.
26221053 a pathway in which TNFalpha-NF-kappaB signaling switches off negative regulation by suppressing HNF-1alpha-mediated expression of miR-194, revealing insight into the mechanisms linking inflammatory pathways, miRNA, and HCC metastasis.
26174136 rs1169288 in HNF1A significantly associates with alpha-1 antitrypsin levels.
25987348 Plasma ghrelin level is higher in HNF1A-maturity onset diabetes of the young than in the common polygenic forms of diabetes.
25979074 An increase in ghrelin gene transcript and a decrease in glucose-dependent insulinotropic polypeptide (GIP) gene transcripts and protein were observed in the gut of Hnf1alpha-null mice.
25957097 aa 121 to 126 of NS5A is important for the degradation of host HNF-1alpha.
25935773 Pregnant MODY patients had higher fasting and postprandial glycemic excursions in the first trimester of GCK mutation MODY pregnancies when compared to HNF-1alpha mutation MODY pregnancies despite insulin treatment.
25793983 These observations provide experimental evidence supporting a possible tumor suppressor role of HNF1A in pancreatic cancer.
25700366 This review summarizes recent findings on the role of HNF4a in cell proliferation and highlights the newly understood function of this old receptor.
25652089 HNF1alpha, but not HNF1beta, is the primary positive regulator of PCSK9 transcription in mouse liver
25646419 study identified TCF1 and LEF1 as Tax antagonistic factors in vivo, a fact which may critically influence the peripheral T-cell tropism of this virus
25456640 Mutations in HNF1A are the most common cause of MODY, Diabetes develops by age 25 years in more than 60% of mutation carriers.45 Sulfonylureas are the treatment of choice.
25445224 This study indicates that the competitive actions of HNF-1alpha and HNF-4alpha on their overlapping binding sites in the human BCMO1 gene promoter oppositely regulate BCMO1 gene expression in the human small intestine.
25414397 Low prevalence of HNF1A mutations in italian families in diabetes clinic.
25414359 The study concludes that the TCF C-clamp DNA binding domain enables gene regulation independent of canonical Wnt Response Element interactions in modulating the DNA activities and transcriptional output of the TCF1E isoform.
25233928 Low HNF1A expression is associated with pancreatic cancer.
25174781 GCK mutations were found in 8 families, all patients with mild asymptomatic hyperglycaemia; 3 of them are novel: p.Asp365Asn, p.Gly81Asp and p.Val253Leu. Previously described mutations in HNF1A were found in 2 families.
25076298 Data suggest women with hepatic adenoma, now reclassified as inflammatory hepatic adenoma, exhibit mutations in HNF1A (hepatic nuclear factor 1 alpha), CTNNB1 (beta-catenin), and gp130/IL6ST (glycoprotein subunit 130, interleukin-6 receptor). [REVIEW]
24933231 The present study aimed to investigate whether associations between the common HNF1A gene variant p.I27L (rs1169288) and risk of type 2 diabetes mellitus are affected by body weight.
24915262 identified a single low-frequency variant in the MODY3-causing gene HNF1A that is associated with type 2 diabetes in Latino populations and may affect protein function
24858819 Elevated TCF-1 and LEF-1 expression is characteristic of malignant gliomas
24847765 Tcf1 and Lef1 cooperate with Runx factors to achieve stable silencing of the Cd4 gene in CD8(+) T cells.
24821553 Our results suggested that ATM regulates the activity of HNF1alpha by phosphorylation of serine 249, particularly in glucose metabolism, which provides valuable insights into the undiscovered mechanisms of ATM in the regulation of glucose homeostasis.
24733486 HNF1alpha-transfected Hep G2 enhanced the CYP3A4 expression in a time- and dose-dependent manner.
24647409 pigs harboring the dominant-negative mutant human MODY3 gene showed reproducible and distinct glomerular nodules.
24642958 We described a novel c.618G>A, p.W206X mutation in HNF1alpha associated with maturity onset diabetes of the young type 3, but not with hepatocellular adenoma. In contrast to most MODY 3 mutations, treatment with sulphonylurea was found to be ineffective.
24559927 Data suggest that HNF1A is involved in regulation of both cell proliferation and function (glucose-stimulated insulin secretion) in pancreatic beta cells. [REVIEW]
24442509 The minor rs1183910 A allele prompts a potential adverse metabolic profile with increased levels of non-fasting glucose, cholesterol, LDL-cholesterol, ApoB, and alkaline phosphatase, but decreased levels of CRP, gamma-glutamyltransferase and bilirubin.
24323243 Mutations in GCK, HNF1A or HNF4A genes were detected in 58 of 150 individuals. Parents of 28 probands were unavailable for further analysis, and in 19 probands the mutation was inherited from an asymptomatic parent.
24100303 conclude that HNF1alpha can induce the expression of ACE2 in pancreatic islet cells via evolutionarily conserved HNF1 binding sites in the ACE2 promoter
24014008 Genetic screening detected a mutation p. Arg200Trp in the HNF1A gene in the patient, her mother, and maternal grandmother, suggesting a diagnosis of MODY-3
23981200 It is involved in hepatic gene transcription in patients undergoing curative resection for hepatocellular carcinoma (HCC).
23978712 HCV core represses ANGPTL-3 expression through loss of HNF-1alpha binding activity and blockage of LXR/RXR transactivation
23922447 HNF1 regulates organic cation transporter 1 (OCT1) transcription and contributes to the strong, liver-specific expression of OCT1.
23878349 Heterozygous mutations in the GCK and HNF1A/ HNF1A 4A genes account for up to 80% of all Maturity onset diabetes of the young cases. (Review)
23803251 PSP/reg and CRP are differentially regulated by HNF1A and HNF4A in maturity-onset diabetes of the young
23760703 MODY subtype with HNF1A mutations.
23721685 Genetic polymorphisms of UGT1A8, UGT1A9 and HNF-1alpha and gastrointestinal symptoms in renal transplant recipients taking mycophenolic acid.
23707370 Report three members of one family with a novel germline in-frame deletion of HNF1A exons 2-3. All three family members have MODY3 in association with primary liver cell tumours, liver adenomatosis, and hepatocellular carcinoma.
23679181 clinicians should always consider the possible diagnosis of MODY3 in a diabetic child with a family history of young-onset diabetes and should perform molecular investigations.
23616187 The mutation causes a dominant-negative HNF1A protein variant which blocks HNF1A wild-type-mediated gene expression.The novel Q495X mutation is the likely cause of our patient's diabetes and hepatic adenomatosis.
23607861 BA synthesis is increased in patients with MODY3 compared with control subjects. Mutations in HNF1alpha affect promoters involved in BA metabolism.
23603156 results suggest that 14-3-3zeta may be an endogenous physiologic regulator of HNF1alpha
23551881 report of 2 sisters with childhood onset diabetes who are both heterozygous for the most common mutation in each of 2 transcription factors, HNF1A, and HNF4A; study of genotypes and phenotypes within the family to investigate the digenic inheritance
23517481 In the cohort of patients fulfilling strict clinical criteria for MODY, 12% carried an HNF1A gene mutation, suggesting that defects of this gene are responsible for a significant proportion of monogenic diabetes in the Greek population.
23430038 Patients with mutations in NKX2-1 may present with pulmonary manifestations in the newborn period or during childhood when thyroid or neurologic abnormalities are not apparent.
23348805 identification of an HNF1A or HNF4A gene mutation has important implications for clinical management in diabetes and pregnancy, but MODY is significantly underdiagnosed.
23274891 Glycan profiles are altered substantially in HNF1A-MODY, and the DG9-glycan index has potential clinical value as a diagnostic biomarker of HNF1A dysfunction.
23183503 No association was observed between polymorphisms within the HNF1-alpha and ANGPTL4 genes and the risk of acute coronary syndrome in the Czech population.
23052196 Arsenite induced down-regulation of HNF1alpha and HNF4alpha under chronic settings may play a central role in the features of disease and cancer observed both in vivo and in vitro.
23009393 Carriers of both GCK and HNF1A mutations manifested a typical maturity-onset diabetes of the young 3 phenotype and showed that the presence of a second mutation in the GCK gene apparently did not modify the clinical outcome.
22993150 Hepatitis C virus (HCV)-induced downregulation of HNF-1alpha expression may play a crucial role in glucose metabolic disorders caused by HCV.
22849862 SNP rs2259816 in the HNF1A gene tended to associate with diabetic nephropathy in type 1 diabetic patients
22802087 Mutations in HNF1A (MODY3) can cause hyperinsulinism early in life and diabetes later, similar to the phenotype recently reported for HNF4A (MODY1) mutations.
22798294 Overexpression of hepatocyte nuclear factor-4alpha initiates cell cycle entry, but is not sufficient to promote beta-cell expansion in human islets.
22788528 HNF1A gene was associated with C-reactive protein, and the region including PSMD3 and CSF3 genes was associated with white blood cell count.
22671145 Data suggest that HNF-1a has a role in regulation of gene expression of CFTR (cystic fibrosis transmembrane conductance regulator) in enterocytes; HNF1 is identified as a critical factor binding to a specific site in CFTR intron 11.
22665711 HNF-1-alpha (formerly MODY 3) - the mutations in this gene on chromosome 12 is seen in European patients and can affect insulin secretion.
22569176 Two novel variants in the 3'UTR of HNF1alpha were detected and four SNPs of HNF1alpha show a significant association to cholelithiasis in male gallstone patients.
22517943 Study showed that two germline HNF1A mutations could coexist in the same patient, which could increase the risk of liver adenomatosis.
22474109 Data suggest that proinflammatory cytokines (as up-regulated in microenvironment of hepatocellular carcinoma) down-regulate FXR (farnesoid X-activated receptor) by inhibiting transactivation via HNF1alpha.
22466651 nuclear EBP50 facilitates colon tumorigenesis by modulating the interaction between beta-catenin and TCF-1.
22432108 In the type 1 diabetic group, two HNF1A mutations were found (0.8% prevalence). In type 2 diabetic subjects, 10 HNF1A, two HNF4A, and one GCK mutation were identified
22413961 Data suggested that this substitution in the promoter region affects DNA-protein interaction and HNF-1alpha gene transcription. The mutant may contribute to the development of diabetes in these two nt-128 T-->G pedigrees of Chinese.
22395466 The hypothesis that inactivation of HNF1A promotes branching of glycans was supported by the analysis of plasma N-glycomes in 61 patients with inactivating mutations in HNF1A, where the increase in plasma glycan branching was also observed.
22383952 Sp1, CREB, HNF-1, and NF-Y, known to be responsive to hormones and diet, regulate NAGS transcription
22357705 a novel mechanism of MTP repression that involves binding of NR2F1 to the DR1 element and recruitment of corepressors
22341299 Structural modeling and clinical correlation suggests that the GCK variant causes monogenic diabetes while the variant in HNF1A is unlikely to be pathogenic.
22340386 COX-2 -899C genotype may increase the susceptibility of individuals to hepatitis B-related liver cancer in Gansu province, China.
22290433 Sirt1 regulates the expression of Fxr through hepatocyte nuclear factor 1-alpha.
22160269 role of HNF1alpha/beta in the transcriptional regulation of organic anion transporters and highlighted DNA methylation-dependent gene silencing as one of the mechanisms underlying the tissue-specific transactivation by this master regulator.
22060211 In Japanese patients with pediatric-onset MODY-type diabetes, mutations in known genes were identified at a much higher frequency than previously reported for adult Asians.
21975049 HNF1alpha is not only important for hepatocyte differentiation, but has also a role in the maintenance of epithelial phenotype in hepatocytes.
21814873 Data indicate that hsCRP (blood level of high sensitivity C-reactive protein) is a clinically valid biomarker for diagnosis of HNF1A-MODY (maturity-onset diabetes mellitus due to mutation in hepatocyte nuclear factor 1 alpha) in European populations.
21747169 Cell cycle-related kinase is a direct androgen receptor-regulated gene that drives beta-catenin/T cell factor-dependent hepatocarcinogenesis
21683639 study to establish occurrence of HNF1A and HNF4A mutations in subjects classified clinically as MODY to identify novel mutations and to determine phenotypic features; 7 HNF1A mutations were identified in 11/36 index cases, 2 were novel (S352fsdelG, F426X)
21647738 findings demonstrate convincing evidence that genetic variants in C-reactive protein (CRP), and HNF1A contribute to plasma CRP in Filipino women and provide the first evidence that exposure to a pathogenic environment may modify the genetic influence at the HNF1A, LEPR, and 6q16.1 loci on plasma CRP level
21498636 Of the 1,087 SNPs tested in pancreatic cancer, the strongest association observed was for HNF1A SNP , an SNP known to associate with circulating C-reactive protein.
21454713 the human apolipoprotein M gene is regulated in opposite ways by hepatocyte nuclear factor 1 and Jun transcription factors
21437455 a new mutation for maturity-onset diabetes of the young type 3 and suggest functional significance of this genetic alteration in the insulin secretion process
21429061 In children born to Oji-Cree mothers with pediatric-onset type 2 diabetes, the frequency of having at least one S allele was 91%.
21353246 a family in which 4 individuals in 3 generations were found to have a mutation (Arg80Gln) in hepatocyte nuclear factor 4alpha. Genetic testing was a factor in choosing sulfonylurea therapy for diabetes.
21348892 The predominant expression of hepatocyte nuclear factor 4alpha (HNF4alpha) in thyroid transcription factor-1 (TTF-1)-negative pulmonary adenocarcinoma
21224407 HNF1A-MODY is the second most frequent MODY diagnosis registered in the DPV database, and previously undescribed HNF1A mutations account for about one-third of HNF1A-MODY cases.
21208426 The G319S variant of the HNF1A protein is associated with incident type 2 diabetes in Aboriginal Canadians. Furthermore, cigarette smoking appears to amplify incident diabetes risk in carriers of HNF1A G319S.
21203500 HNF1alpha regulates the expression of fucosyltransferase and fucose biosynthesis genes.
21195701 HNF1A polymorphisms are independently associated with CRP level in Taiwanese
21182953 the HNF1A exon 4 C8-microsatellite is a target for somatic mutations in individuals with biallelic mismatch repair gene mutations, thus predisposing these individuals to the development of hepatic adenomas.
21170474 Results suggest that HNF1A mutations may have differential effects on the regulation of specific target genes, which could contribute to the variability of the MODY3 clinical phenotype.
21168233 Data found eight mutations, of which six were novel and four sequence variants, which were all novel in a Caucasian population clinically characterized as MODY from Argentina.
21062467 Possible association of the rs2259816 polymorphism in the HNF1A gene with circulating level of C-reactive protein and the hazard of coronary artery disease in a Study cohort.
21062467 Observational study of gene-disease association. (HuGE Navigator)
20980261 this study provides a model for an IL-4/STAT6-dependent fine tuning mechanism of TCF-1-driven T helper cell polarization
20971364 Observational study of gene-disease association. (HuGE Navigator)
20863361 Observational study of gene-disease association. (HuGE Navigator)
20829431 Hepatocyte nuclear factor-1alpha (HNF-1alpha) plays an important role in the regulation of organic anion transporter OAT5 and OAT7 gene expression.
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20727736 Observational study of gene-disease association. (HuGE Navigator)
20716378 CRP levels were lower in S319 allele carriers of the HNF1A gene in Canadian Aborigines compared to non-carriers among individuals without diabetes, but this difference was not present among those with diabetes, who uniformly had elevated CRP levels
20716378 Observational study of gene-disease association. (HuGE Navigator)
20705777 The proband carrying both the HNF4A/MODY1 and HNF1A/MODY3 shows a more severe form of diabetes compared with the family members carrying only one mutation.
20690076 a novel nonsense mutation named E41X in a family afflicted with Maturity-Onset Diabetes of the Young with respect to the onset and course of disease.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20648472 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20633866 Mutations of the HNF1B gene are found in women with both uterine and renal abnormalities but are rare in isolated uterine abnormalities.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20581827 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20568120 identified the minimal promoter region of CDH17 that is regulated by HNF1alpha and CDX2 transcriptional factors; Suppression of HNF1alpha and CDX2 expression by siRNA down-regulated expressions of CDH17 and cyclin D1 and the viability of HCC cells
20546258 We have shown that individuals known to have diabetes caused by a mutation in the HNF1A gene have an increased risk of cardiovascular mortality compared with their unaffected family members
20546258 Observational study of gene-disease association. (HuGE Navigator)
20460578 regulation by SREBP2 and HNF1alpha on the NPC1L1 promoter activity
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20396999 The results show that HNF-4alpha serves as a scaffold protein for histone deacetylase activities, thereby inhibiting liver expression of genes including PED.
20394740 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20393147 in a large series of individuals with hepatocellular adenoma (HCA), we observed a significant differences between HNF1A somatic mutations identified in those with HCAs and germline mutations identified in individuals with MODY3
20172480 Occasional difficulties may be encountered when classifying patients with MODY-2, MODY-3 or type 2 diabetes of atypical characteristics, in this case patients who present I27L polymorphism in the HNF1alpha gene
20133952 In cooperation with Cdx2, HNF-1alpha acts as a key factor on human intestinal cells to trigger the onset of their functional differentiation program whereas GATA-4 appears to promote morphological changes.
20132997 three novel mutations causing MODY (Maturity Onset Diabetes of the Young) -two missense mutations in HNF1A [F268L (c.802T>C) and P291S (c.871C>T)] and one frame shift mutation in GCK V244fsdelG (c.729delG
20113359 Observational study of gene-disease association. (HuGE Navigator)
20106981 identified an NKX6.1 recognition sequence in the distal region of the HNF1alpha promoter and demonstrated specific binding of NKX6.1 in beta cells
20096102 DNA methylation of HNF1A could also play an important role in regulating additional cellular drug metabolism and transporter pathways.
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
20069546 Show that the MODY3 mutation and the PSMD9 IVS3 + nt460A/IVS3 + nt437T/G197 SNPs are risk factors for type 2 diabetes in Italian families.
20031592 Common polymorphisms of HNF1A is related to influence multiple phenotypes related to cardiovascular risk in the general population of younger and older European-American adults
20031592 Observational study of gene-disease association. (HuGE Navigator)
20028982 the interaction between Hhex and SOX13 may contribute to control Wnt/TCF1 signaling in the early embryo.
20018894 Data found that human HNF4alpha was down-regulated by miR-24 and miR-34a, the expression of which are regulated by cellular stress, affecting the metabolism and cellular biology.
19933992 In this dataset, serum 1,5-anhydroglucitol was able to discriminate diabetes subtypes, particularly HNF1A mutations.
19924231 analysis of isoform-specific expression of the human, mouse and rat HNF1A, HNF1B and HNF4A genes
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19794065 Type 2 diabetes risk variants of modest effect sizes reduce the age at diagnosis in HNF1A-maturity-onset diabetes of the young.
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19782160 Data show that binding of DHS with sequences of HNF1, CDX2, and PBX1 in vitro contribute to understanding of the complexity of cell-type-specific CFTR regulatory mechanisms.
19749792 dnTCF-1 provides homeostatic regulation of Wnt signaling and growth in normal colon, and the alterations in nuclear export and promoter usage contribute to aberrant Wnt activity in colon cancer.
19741195 HNF-1alpha and/or HNF-1beta binding is required for SVCT1 expression
19687008 Hepatocyte nuclear factor 1alpha plays a critical role in PCSK9 gene transcription and regulation by the natural hypocholesterolemic compound berberine
19672314 conclude that low frequency, nonsynonymous coding variants in the terminal exons of HNF1A are unlikely to contribute to T2D-susceptibility in European samples
19672314 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19567438 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19564454 Observational study of gene-disease association. (HuGE Navigator)
19536331 UCH L1 up-regulates its expression by activation of the oncogenic beta-catenin/TCF signaling
19490620 a late-onset autosomal dominant diabetes mellitus group is enriched for common HNF1A polymorphisms A98V and S487N
19453261 Observational study of gene-disease association. (HuGE Navigator)
19388975 Observational study of genetic testing. (HuGE Navigator)
19357985 Histochemical analysis of pancreas tissue from the cloned pigs showed small and irregularly formed Langerhans Islets, in which poor insulin secretion was detected.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19349540 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19336507 Mutations in the HNF1A gene comprise about 9% of clinically diagnosed MODY subjects in southern India and a novel Arg263His mutation cosegregates with MODY in one family.
19336507 Observational study of gene-disease association. (HuGE Navigator)
19304666 HNF1 binding site and HNF1alpha are critical to liver-specific expression of HPS, and down-regulation or loss of HNF1alpha causes, at least in part, the transcriptional down-regulation of HPS in HCC.
19280766 Review show that HNF1A transcription factor may play a key role in linking metabolic and inflammatory pathways underlying the pathogenesis of coronary heart disease.
19228875 Observational study of gene-disease association. (HuGE Navigator)
19198612 Identification of one new CAD risk locus on 3q22.3 in MRAS, and suggestive association with a locus on 12q24.31 near HNF1A-C12orf43.
19198612 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19188435 Sequences and transciprioal functions are conserved between mice and humans.
19169489 HNF1alpha mutations are a common cause of monogenic diabetes in adults selected with strict clinical diagnostic criteria in a South-Brazilian population
19150152 Alternative splicing mutations are observed in Italian families with type 2 diabetes.
19119252 MODY3 mutations frequencies are not rare in Korean early-onset type 2 diabetes
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18940312 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18854284 the only factor useful in identifying multiple myeloma patients benefiting from anthracycline/thalidomide-based therapy
18811724 Observational study of gene-disease association. (HuGE Navigator)
18777455 Significant associations between the heterozygote A98V genotype and clinical parameters of insulin metabolism were reported but no relationship with type 2 diabetes was obtained.
18777455 Observational study of gene-disease association. (HuGE Navigator)
18720549 Present 2 cases of hepatocyte nuclear factor 1alpha (HNF1alpha)-mutated adenomatosis.
18672310 results suggested that mutations in MODY2 and MODY3 genes do not explain the majority of maturity-onset diabetes of the young (MODY) cases in Brazilian population
18671716 HNF-1alpha contributes to glucose regulation of dipeptidyl peptidase IV gene expression in Caco-2 cells.
18593771 HNF1A mutation carriers have reduced pancreatic volume but less reduced than in patients with type 1 diabetes.
18593771 Observational study of gene-disease association. (HuGE Navigator)
18586913 A combination of abnormal splicing and reduced activity of the HNF1A protein may explain the diabetes susceptibility in a Canadian Ofi-Cree population.
18513305 Observational study of gene-disease association. (HuGE Navigator)
18513302 Observational study of gene-disease association. (HuGE Navigator)
18498634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18440731 our data suggest a major role of HNF-1alpha in control of FABP2 expression in intestine via a functional HNF-1alpha recognition element within FABP2 promoter region -185 to -165.
18439552 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18439552 There are several SNPs within a 5 kb region of HNF1A intron 1 with the strongest evidence of association with CRP phenotype.
18439548 Observational study of gene-disease association. (HuGE Navigator)
18433912 Identification of a new mutation of the HNF-1alpha sequence in a child with a diabetic mother.
18433021 Beta-catenin and HNF1alpha could regulate miR-375 and miR-107 expression levels, respectively, in hepatocellular tumors.
18399756 HNF-1alpha mRNA was expressed in four of the six anaplastic papillary thyroid cancer cell lines.
18391435 In order to elucidate the molecular basis of HNF4 function and the monogenic causes of diabetes, HNF4 DNA-binding domain is prepared and crystallized in complex with a high-affinity HNF1 promoter element containing the HNF4 recognition sequence.
18346225 Data show that a concerted action of HNF4alpha and HNF1alpha, which also determines morphological and functional differentiation of hepatocytes, links HBV replication to hepatocyte differentiation.
18332101 Observational study of gene-disease association. (HuGE Navigator)
18221440 Coexistence of type 1 diabetes autoimmunity and a mutation in the gene for MODY3 in this overweight patient may explain the early onset of progressive insulinopenia compared with the later age of diabetes onset.
18172616 HNF1alpha bound to the proximal promoter motif enhances basal reporter activity of UGT1A1, including distal (-3570/-3180) and proximal (-165/-1) regions, and influences transcriptional regulation of UGT1A1 by CAR, PXR, GR, and AhR
18080173 HNF4alpha plays a crucial role in the expression and regulation of human NPC1L1 gene
18003757 Part of the variability of the clinical expression in MODY3 patients may be explained by the type and the location of HNF1A mutations.
18003757 Observational study of gene-disease association. (HuGE Navigator)
17965524 HNF1alpha and HNF4alpha are the factors involved in the interindividual variability of liver UGT1A6 and UGT1A9 mRNA expression.
17937063 An 11 bp deletion, including the splice site at the end of exon 2 was found; however the location of the mutation in the DNA-binding domain does not affect the function of TCF1.
17932728 HNF1alpha is an essential regulator of OATP1B1 mRNA expression and thus the level of HNF1alpha expression is one of the major determinants of interindividual variability in OATP1B1 mRNA expression.
17828387 Deletions are detected in exons are investigated in maturity-onset diabetes of the young.
17638895 Fascin is a novel target of beta-catenin-TCF signaling and is expressed at the invasive front of human colon cancer
17601994 Observational study of gene-disease association. (HuGE Navigator)
17573900 Almost 90% of the MODY cases in the group studied are explained by mutations in the major genes GCK (MODY2) and HNF-1alpha(MODY3), although differences in the relative prevalence of each form could be partly due to patient referral bias.
17569132 hepatocellular adenomas can be divided into 4 subgroups: one is defined by presence of mutations in TCF1 gene inactivating HNFalpha; 2nd by presence of beta-catenin activating mutations; category without mutations divided based on presence of inflammation
17475670 Transcription factors glucocorticoid receptor, STAT-3, and HNF-1alpha bind to the angiotensinogen gene promoter mediating IL-6 induced promoter activity of this gene.
17458140 Observational study of gene-disease association. (HuGE Navigator)
17440429 Provide evidence for HNF1alpha as a determinant of UGT1A1, UGT1A9 and UGT2B7 mRNA expression, but suggest a role for multiple transcription factors.
17440016 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17440016 despite a significant proportion of young Indians with type 2 diabetes a having normal weight, HNF1alpha gene mutations were infrequent
17407072 HNF-1A gene is not a common cause of early-onset and/or multiplex diabetes among Chinese patients.
17407072 Observational study of gene-disease association. (HuGE Navigator)
17327436 Observational study of gene-disease association. (HuGE Navigator)
17327436 A study evaluating the extent to which common variation in the six known maturity-onset diabetes of the young (MODY) genes, which cause a monogenic form of type 2 diabetes, is associated with type 2 diabetes is presented.
17264800 two hepatocyte nuclear factor 1-binding elements are involved for the UDP-glucuronosyltransferase 1A9 promoter response to hepatocyte nuclear factor 4alpha
17194452 glucose regulation of sucrase-isomaltase gene expression was attenuated in HNF-1alphaT539fsdelC cells, but was well maintained in empty vector & HNF-1betaR177X cells.Results suggest that HNF-1alpha participates in glucose regulation of SI gene expression.
17192490 Observational study of gene-disease association. (HuGE Navigator)
17130528 Observational study of genotype prevalence. (HuGE Navigator)
17116178 G574S affects the transactivation potential of HNF-1alpha on the insulin promoter in pancreatic beta-cells
17049664 In steatotic adenoma, we identified an inactivating biallelic mutation of HNF1alpha.
17037983 HNF1alpha regulates endogenous MUC4 expression by binding to two cognate cis-elements respectively located at -3332/-3327 and -3040/-3028 in the distal promoter.
17033837 Observational study of gene-disease association. (HuGE Navigator)
17021248 IL-1beta caused concentration-related up-regulation of vHNF-1C mRNA levels and increased binding of HNF-1C protein to the HRE, whereas HNF-1alpha-response element complex formation was reduced.
17021248 IL-1beta represses GSTA1 transcription via a mechanism involving overexpression of variant HNF-1C.
16963153 The prevalence of mutations in the HNF1A gene was studied in Polish women with gestational diabetes.
16930618 substitutions G20R and G20A lead to dimeric molten globules of low stability, suggesting that the impaired function of the diabetes-associated transcription factor is due to a main-chain perturbation rather than to specific features of the Arg side-chain
16893891 HNF4alpha, CREM, HNF1alpha, and C/EBPalpha have roles in transcriptional regulation of the glucose-6-phosphatase gene by cAMP/vasoactive intestinal peptide in the intestine
16873704 Observational study of gene-disease association. (HuGE Navigator)
16793932 These results indicate that the tissue-specific expression of hOAT3 might be regulated by the concerted effect of genetic (HNF1alpha and HNF1beta) and epigenetic (DNA methylation) factors.
16788384 Cdx2 was shown to cooperatively activate the UGT2B7 promoter in conjunction with hepatocyte nuclear factor 1alpha (HNF1alpha), a mechanism previously observed to regulate other intestine-specific genes.
16781669 both wild HNF-1alpha and wild HNF-1beta have a stimulatory effect on dipeptidylpeptidase IV gene expression, but that mutant HNF-1alpha and mutant HNF-1beta attenuate the stimulatory effect
16760222 examined whether the isomers affected by the mutation altered the diabetes phenotype in 564 subjects with 123 mutations in HNF1A
16752173 Observational study of gene-disease association. (HuGE Navigator)
16752173 The -30G-->A polymorphism of the beta-cell-specific promoter of GCK and the I27L polymorphism of HNF1A seem to increase the risk of GDM in Scandinavian women.
16714285 NARF functions as a novel ubiquitin-ligase to regulate ubiquitylation and degradation of T cell factor/lymphoid enhancer factor
16712787 STMN2 is required for maintaining the anchorage-independent growth state of beta-catenin/TCF-activated hepatoma cells
16675441 HNF1 binding, at approximately 51 kb upstream, plays a master role in controlling human class I alcohol dehydrogenase gene expression.
16632067 Observational study of genotype prevalence. (HuGE Navigator)
16562587 Observational study of genotype prevalence. (HuGE Navigator)
16562587 In HNF-1alpha, previously reported mutations (R271W and R272C) and one novel sequence variant (at nucleotide -129/-130 insTTGGGG of the promoter region) were identified in three different Japanese patients with juvenile-onset non-obese diabetes mellitus.
16443774 Subjects with HNF-1beta mutations have reduced insulin sensitivity of endogenous glucose production but normal peripheral insulin sensitivity in contrast to patients with HNF-1alpha mutations and normal controls.
16442529 Expressed Bcr is able to bind the transcription factor Tcf1 to disrupt the Tcf1/beta-catenin complex. Phosphorylation of Bcr by the tyrosine kinase pp60(src) can lead to dissociation of the transcriptionally inactive Bcr/Tcf1 complex
16367885 Observational study of gene-disease association. (HuGE Navigator)
16297991 we identified that the related transcription factor HNF1alpha (TCF1) affects only nine genes in HEK293 cells and thus is a less efficient factor in these kidney cells
16276364 Observational study of gene-disease association. (HuGE Navigator)
16254374 Core promoter upstream regulatory sequence/basic core promoter was replaced with a part of the S1 promoter covering the hepatocyte nuclear factor 1 (HNF1) binding site, followed by a tandem repeat of the HNF1 site.
16249556 Renal malformations may be linked to mutations in the MODY3 gene.
16241915 Observational study of gene-disease association. (HuGE Navigator)
16223942 HNF-1alpha-HNF-4alpha functional interactions are accomplished by regulating factor promoter occupancy and defective factor-factor interactions may contribute to the maturity onset diabetes of the young phenotype.
16186275 Observational study of gene-disease association. (HuGE Navigator)
16186275 Among Asian Indians, the Ala98Val polymorphism of HNF1alpha gene is associated with MODY and with earlier age at onset of type 2 diabetes.
16046319 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16046299 Observational study of gene-disease association. (HuGE Navigator)
15983330 Beta-cell deficiency, increased insulin sensitivity, and a low renal threshold are present in young nondiabetic HNF-1alpha mutation carriers.
15983230 Observational study of gene-disease association. (HuGE Navigator)
15961790 transcription factors hepatic nuclear factor 1 (HNF1)alpha and beta play an important part in the regulation of the ACAT2 promoter
15930087 Observational study of gene-disease association. (HuGE Navigator)
15928245 relative prevalence of 3% of MODY1 (two different mutations in two families), 10% of MODY2 (seven in eight), and 36% of MODY3 (21 in 28) among Danish kindred clinically diagnosed as MODY
15899904 cyclooxygenase-2/PGE2 may exert pro-oncogenic actions through stimulating the beta-catenin/T cell factor-mediated transcription, which plays critical roles in colorectal carcinogenesis
15847654 Observational study of genetic testing. (HuGE Navigator)
15841481 3 novel mutations within the TCF1 gene, associated with Maturity-onset diabetes of the young, are discussed.
15830177 Observational study of gene-disease association. (HuGE Navigator)
15740590 Albumin colocalized together with its transcription factor PCD/DCoH/HNF-1alpha in suprabasal keratinocytes in human full-thickness skin sections and in keratinocytes cultured in serum-free medium.
15660729 Observational study of gene-disease association. (HuGE Navigator)
15660195 Observational study of gene-disease association. (HuGE Navigator)
15569134 Observational study of gene-disease association. (HuGE Navigator)
15542842 TCF-SRF-regulated gene activity has a role in regulating proliferation and in protecting cells from apoptotic cell death
15522234 These results suggest that sucrase-isomaltase transcription might be unchanged or lower in maturity-onset diabetes of the young (MODY) type 3, but greater in MODY5.
15520459 A comparision of gene expression patterns induced by hepatic nuclear factors, HNF6, HNF4alpha and HNF1beta, in a pancreatic beta-cell line.
15326484 HNF1alpha may contribute to endometrial carcinogenesis through complete HNF1alpha inactivation like in liver cell adenoma or by haploinsufficiency like in MSI-H colorectal cancer
15305805 a mutation of the HNF1A gene was found in families and patients with maturity-onset diabetes of the young
15300627 HNF-1 alpha gene is not a major cause of early-onset or multiplex diabetes pedigrees in this Chinese population in Shanghai.
15300627 Observational study of gene-disease association. (HuGE Navigator)
15277395 Observational study of gene-disease association. (HuGE Navigator)
15277395 Polymorphism contributes to glucose intolerance in a South Indian population
15270800 Observational study of gene-disease association. (HuGE Navigator)
15217781 Cdx-2 is a permissive factor that influences basal CaBP expression in enterocytes and that HNF-1alpha modulates CaBP gene expression during cellular differentiation.
15194767 HNF1 did not affect the Hepatitis B virus WT core promoter, but suppressed the precore RNA expression of the double mutant in Huh7 hepatoma cells
15111528 diabetes phenotype due to HNF-1beta mutations is similar to that in HNF-1alpha
14988562 identifed systematically the genes occupied by the transcriptional regulators HNF1alpha, HNF4alpha, and HNF6, together with RNA polymerase II in human liver and pancreatic islets
14747304 study provides the first evidence that HNF-1alpha PTC mutations may be subject to nonsense-mediated decay
14728801 HNF1 and hB1F are involved together in the viral gene expression regulation of the Hepatitis B virus.
14583183 Observational study of gene-disease association. (HuGE Navigator)
14575719 findings suggest that HNF1 may have a major role in upregulating alternative transcription of the AE2 gene in the liver, and therefore it may contribute to the biliary secretion of bicarbonate in response to certain stimuli
12934344 Observational study of gene-disease association. (HuGE Navigator)
12860991 HNF1 functionally replaces both vHNF1 isoforms, suggesting that the different developmental functions of these transcription factors are mainly due to the acquisition of novel expression patterns
12794133 A newly characterized binding site for HNF-1 upstream of the STAT6 site in intron 1 of the human polymeric Ig receptor gene shows that HNF-1 is required for complete function of the IL-4-responsive enhancer in HT-29 epithelial cells.
12788852 Observational study of gene-disease association. (HuGE Navigator)
12788852 HNF-1 alpha gene locus is associated with serum HDL-c level, and Ile27 allele is a risk marker for atherosclerosis.
12773136 role of the I27L polymorphism in the pathogenesis of type 2 diabetes
12762846 Gene expression data from transgenic mice lacking HNF1alpha can be used to identify DNA binding sites for that factor.
12743700 Observational study of gene-disease association. (HuGE Navigator)
12743700 Single nucleotide polymorphism is not associated with ketosis-prone atypical diabetes.
12730871 role for HNF1 in microsatellite instability status in colorectal carcinogenesis
12726923 Observational study of gene-disease association. (HuGE Navigator)
12712243 Mutation of HNF-1alpha at codon 263 from arginine to leucine leads to the development of MODY3.
12707037 loss of expression of this transcription factor in a subset of peripheral t-cell lymphomas
12627330 20 different mutations in the HNF-4alpha, GCK and HNF-1alpha in 29 families. Three of 3, 10 of 11 and 1 of 6 of the mutations identified in HNF-4alpha, GCK and HNF-1alpha respectively, were new.
12605834 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12574234 that beta-cell dysfunction in MODY3 is caused by loss-of-function mechanisms like reduced DNA binding, impaired transcriptional activation, and defects in subcellular localization.
12565907 Data reveal DCoH/HNF-1 alpha expression and transcriptional activity in human epidermal melanocytes in vitro and in situ and identified tyrosinase, the key enzyme for pigmentation, as a new transcriptional target.
12547858 prevalence of HNF-1alpha mutations in families with three generations of diabetes, representing a subpopulation in which misclassification was likely
12544512 results suggest that the expression level of dihydrodiol dehydrogenase 4 mRNA is cooperatively regulated by the amounts of HNF-1 alpha, HNF-4 alpha and HNF-4 gamma
12530534 haploinsufficiency of HNF1alpha is responsible for the pathogenesis of MODY3
12488962 The L518P519fsTCC --> A was identified for the first time and this mutation might be a common cause of Japanese MODY3 in Okinawa area. In addition, both the T521I and V617I mutations were present in two patients in the same family.
12488961 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12488961 Non-obese Japanese patients with non-Type 1 diabetes of youth have HNF-1alpha-deficient diabetes. Lack of obesity could well be a characteristic feature of this form of diabetes.
12488960 The L107I/HNF1alpha protein showed normal nuclear targeting but impaired binding to an HNF1 alpha consensus sequence. L107I substitution represents a MODY3 mutation which impairs beta-cell function by a loss-of-function mechanism.
12453976 Mutations in HNF-1alpha accounts for diabetes in a small proportion of families with a dominant pattern of inheritance; age at onset of diabetes in MODY3 families varied widely and is influenced by familial factors
12453975 maternal hyperglycemia during pregnancy probably increases the penetrance of HNF-1alpha mutations
12453961 Observational study of gene-disease association. (HuGE Navigator)
12453961 A missense mutation is prevalent in Canadian aboriginal youth with type 2 diabetes.
12453420 x-ray crystallography reveals a stable interface that further distinguishes HNF-1alpha from other flexible POU-homeodomain proteins
12442280 Three HNF1A mutations, of which two were novel, namely 1051delCA and Q250X, were identified in Canadian MODY patients.
12378390 Abnormal splicing is demonstrated in this gene in maturity-onset diabetes of the young.
12355088 results indicate that inactivation of TCF1, whether sporadic or associated with MODY3, is an important genetic event in the occurrence of human liver adenoma, and may be an early step in the development of some HCCs
12235114 These findings provide genetic evidence that HNF-1alpha serves as an upstream regulator of HNF-4alpha and interacts directly with the P2 promoter in human pancreatic cells.
12107757 Mutations in the HNF-1 alpha gene seem to be an important cause of MODY in southern Chinese. The mutations could affect normal islet function by altering the expression of target genes.
12050210 mutations in maturity-onset diabetes of the young (MODY) candidate genes in 22 Spanish families.
12012276 Observational study of gene-disease association. (HuGE Navigator)
12011060 Physical interaction with GATA-5 results in synergistic activation of the human lactase-phlorizin hydrolase promoter.
11938027 Observational study of gene-disease association. (HuGE Navigator)
11938027 Prevalence of the missense mutation Gly574Ser in the hepatocyte nuclear factor-1alpha in Africans with diabetes
11827432 Observational study of gene-disease association. (HuGE Navigator)
11827432 Mutation in hepatocyte nuclear factor-1alpha is not a common cause of MODY and early-onset type 2 diabetes in Korea.
11772903 Observational study of gene-disease association. (HuGE Navigator)
11668618 analysis of a non-functional mutation in Japanese subjects with familial type 1 diabetes
11522670 Observational study of gene-disease association. (HuGE Navigator)
11440371 Uncategorized study of genetic testing. (HuGE Navigator)

AA Sequence

MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGS      1 - 70
EDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLN     71 - 140
QSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPAS    141 - 210
QQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHK    211 - 280
LAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQ    281 - 350
VSPTGLEPSHSLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPA    351 - 420
SLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPVQSHVTQSPFM    421 - 490
ATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPAS    491 - 560
QATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSS    561 - 630
Q//

Text Mined References (383)

PMID Year Title
26855178 2016 Hepatocyte nuclear factor 1 coordinates multiple processes in a model of intestinal epithelial cell function.
26776850 2016 PET-avid hepatocellular adenomas: incidental findings associated with HNF1-? mutated lesions.
26714756 2015 Identification of a novel mechanism of action of fingolimod (FTY720) on human effector T cell function through TCF-1 upregulation.
26549228 2015 Repression of HNF1?-mediated transcription by amino-terminal enhancer of split (AES).
26446475 2015 Half-Life of Sulfonylureas in HNF1A and HNF4A Human MODY Patients is not Prolonged as Suggested by the Mouse Hnf1a(-/-) Model.
26436572 2015 Hepatocyte nuclear factor-? genetic mutation in a Chinese pedigree with maturity-onset diabetes of the young (MODY3).
26274031 2015 Simultaneous occurrence of focal nodular hyperplasia and HNF1A-inactivated hepatocellular adenoma: a collision tumor simulating a composite FNH-HCA.
26240958 2015 Prevalence of Retinopathy in Adult Patients with GCK-MODY and HNF1A-MODY.
26221053 2015 NF-?B signaling relieves negative regulation by miR-194 in hepatocellular carcinoma by suppressing the transcription factor HNF-1?.
26174136 2015 Three missense variants of metabolic syndrome-related genes are associated with alpha-1 antitrypsin levels.
25987348 2015 Circulating ghrelin level is higher in HNF1A-MODY and GCK-MODY than in polygenic forms of diabetes mellitus.
25979074 2015 Ghrelin Inhibition Restores Glucose Homeostasis in Hepatocyte Nuclear Factor-1? (MODY3)-Deficient Mice.
25957097 2015 A single-amino-acid mutation in hepatitis C virus NS5A disrupts physical and functional interaction with the transcription factor HNF-1?.
25935773 2015 The clinical management of hyperglycemia in pregnancy complicated by maturity-onset diabetes of the young.
25793983 2015 Hepatocyte nuclear factor 1A (HNF1A) as a possible tumor suppressor in pancreatic cancer.
25700366 2015 Role of hepatocyte nuclear factor 4? (HNF4?) in cell proliferation and cancer.
25652089 2015 Reduction of circulating PCSK9 and LDL-C levels by liver-specific knockdown of HNF1? in normolipidemic mice.
25646419 2015 TCF1 and LEF1 act as T-cell intrinsic HTLV-1 antagonists by targeting Tax.
25456640 2015 Update on diabetes classification.
25445224 2014 Competitive regulation of human intestinal ?-carotene 15,15'-monooxygenase 1 (BCMO1) gene expression by hepatocyte nuclear factor (HNF)-1? and HNF-4?.
25414397 2014 Low prevalence of HNF1A mutations after molecular screening of multiple MODY genes in 58 Italian families recruited in the pediatric or adult diabetes clinic from a single Italian hospital.
25414359 2014 The TCF C-clamp DNA binding domain expands the Wnt transcriptome via alternative target recognition.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25233928 2014 Transcriptome analysis of pancreatic cancer reveals a tumor suppressor function for HNF1A.
25174781 2014 Three unreported glucokinase (GCK) missense mutations detected in the screening of thirty-two Brazilian kindreds for GCK and HNF1A-MODY.
25076298 2014 Update on the new classification of hepatic adenomas: clinical, molecular, and pathologic characteristics.
24933231 2015 Associations between the common HNF1A gene variant p.I27L (rs1169288) and risk of type 2 diabetes mellitus are influenced by weight.
24915262 2014 Association of a low-frequency variant in HNF1A with type 2 diabetes in a Latino population.
24858819 2014 Wnt signaling transcription factors TCF-1 and LEF-1 are upregulated in malignant astrocytic brain tumors.
24847765 2014 From inception to output, Tcf1 and Lef1 safeguard development of T cells and innate immune cells.
24821553 2014 Serine 249 phosphorylation by ATM protein kinase regulates hepatocyte nuclear factor-1? transactivation.
24763700 2014 New variants including ARG1 polymorphisms associated with C-reactive protein levels identified by genome-wide association and pathway analysis.
24733486 2014 Enhancement of CYP3A4 activity in Hep G2 cells by lentiviral transfection of hepatocyte nuclear factor-1 alpha.
24647409 2014 Diffuse glomerular nodular lesions in diabetic pigs carrying a dominant-negative mutant hepatocyte nuclear factor 1-alpha, an inheritant diabetic gene in humans.
24642958 2014 A family with a novel termination mutation in hepatic nuclear factor 1? in maturity-onset diabetes of the young type 3 which is unresponsive to sulphonylurea therapy.
24559927 2014 Roles of HNF1? and HNF4? in pancreatic ?-cells: lessons from a monogenic form of diabetes (MODY).
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24442509 2014 Pleiotropic effects of HNF1A rs1183910 in a population-based study of 60,283 individuals.
24323243 2014 De novo mutations of GCK, HNF1A and HNF4A may be more frequent in MODY than previously assumed.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100303 2013 The transcription factor HNF1? induces expression of angiotensin-converting enzyme 2 (ACE2) in pancreatic islets from evolutionarily conserved promoter motifs.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24014008 2014 Mody-3: novel HNF1A mutation and the utility of glucagon-like peptide (GLP)-1 receptor agonist therapy.
23981200 2014 Prognostic value of hepatocyte nuclear factors 4? and 1? identified by tissue microarray in resectable hepatocellular carcinoma.
23978712 2014 Hepatitis C virus modulates lipid regulatory factor Angiopoietin-like 3 gene expression by repressing HNF-1? activity.
23922447 2013 Hepatocyte nuclear factor 1 regulates the expression of the organic cation transporter 1 via binding to an evolutionary conserved region in intron 1 of the OCT1 gene.
23878349 2013 Maturity onset diabetes of the young: identification and diagnosis.
23844046 2013 Are C-reactive protein associated genetic variants associated with serum levels and retinal markers of microvascular pathology in Asian populations from Singapore?
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
23803251 2013 Effects of hepatocyte nuclear factor-1A and -4A on pancreatic stone protein/regenerating protein and C-reactive protein gene expression: implications for maturity-onset diabetes of the young.
23760703 2013 Monogenic diabetes: old and new approaches to diagnosis.
23721685 2013 Genetic polymorphisms of UGT1A8, UGT1A9 and HNF-1? and gastrointestinal symptoms in renal transplant recipients taking mycophenolic acid.
23707370 2013 Primary hepatocellular neoplasms in a MODY3 family with a novel HNF1A germline mutation.
23679181 2013 Japanese boy with maturity-onset diabetes of the young type 3 who developed diabetes at 19 months old.
23616187 2013 Maturity-onset diabetes of the young and hepatic adenomatosis - characterisation of a new mutation.
23607861 2013 Alterations in bile acid synthesis in carriers of hepatocyte nuclear factor 1? mutations.
23603156 2013 14-3-3? interacts with hepatocyte nuclear factor 1? and enhances its DNA binding and transcriptional activation.
23551881 2013 Digenic heterozygous HNF1A and HNF4A mutations in two siblings with childhood-onset diabetes.
23517481 2013 The spectrum of HNF1A gene mutations in Greek patients with MODY3: relative frequency and identification of seven novel germline mutations.
23430038 2013 Heterogeneous pulmonary phenotypes associated with mutations in the thyroid transcription factor gene NKX2-1.
23348805 2013 Mutations in the genes encoding the transcription factors hepatocyte nuclear factor 1 alpha and 4 alpha in maturity-onset diabetes of the young and hyperinsulinemic hypoglycemia.
23274891 2013 Mutations in HNF1A result in marked alterations of plasma glycan profile.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23183503 2012 Variants within HNF1? and ANGPTL4 genes and acute coronary syndrome in Czech population. The GENDEMIP study.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23052196 2013 Inhibition of hepatocyte nuclear factor 1 and 4 alpha (HNF1? and HNF4?) as a mechanism of arsenic carcinogenesis.
23009393 2013 Co-inheritance of HNF1a and GCK mutations in a family with maturity-onset diabetes of the young (MODY): implications for genetic testing.
22993150 2012 Hepatitis C virus infection suppresses GLUT2 gene expression via downregulation of hepatocyte nuclear factor 1?.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22849862 2012 Genetic and functional analyses of MRAS and HNF1A genes in diabetes and diabetic nephropathy.
22802087 2012 Novel presentations of congenital hyperinsulinism due to mutations in the MODY genes: HNF1A and HNF4A.
22798294 2012 Overexpression of hepatocyte nuclear factor-4? initiates cell cycle entry, but is not sufficient to promote ?-cell expansion in human islets.
22788528 2013 Genetic associations with C-reactive protein level and white blood cell count in the KARE study.
22671145 2012 Transcriptional networks driving enhancer function in the CFTR gene.
22665711 2012 Diabetes in the young but not needing insulin--what type is it?
22569176 2012 MALDI-TOF mass spectrometry screening of cholelithiasis risk markers in the gene of HNF1alpha.
22517943 2012 Double heterozygous germline HNF1A mutations in a patient with liver adenomatosis.
22474109 2012 Hepatocarcinogenesis in FXR-/- mice mimics human HCC progression that operates through HNF1? regulation of FXR expression.
22466651 2012 Aberrant nuclear localization of EBP50 promotes colorectal carcinogenesis in xenotransplanted mice by modulating TCF-1 and ?-catenin interactions.
22432108 2012 Systematic assessment of etiology in adults with a clinical diagnosis of young-onset type 2 diabetes is a successful strategy for identifying maturity-onset diabetes of the young.
22413961 2012 Functional analyses of the mutation nt-128 T?G in the hepatocyte nuclear factor-1? promoter region in Chinese diabetes pedigrees.
22395466 2012 Epigenetic silencing of HNF1A associates with changes in the composition of the human plasma N-glycome.
22383952 2012 Transcriptional regulation of N-acetylglutamate synthase.
22357705 2012 NR2F1 disrupts synergistic activation of the MTTP gene transcription by HNF-4? and HNF-1?.
22341299 2012 Clinical assessment of HNF1A and GCK variants and identification of a novel mutation causing MODY2.
22340386 2011 Cyclooxygenase-2 promoter polymorphism -899G/C is associated with hepatitis B-related liver cancer in a Chinese population of Gansu province.
22290433 2012 Hepatic deletion of SIRT1 decreases hepatocyte nuclear factor 1?/farnesoid X receptor signaling and induces formation of cholesterol gallstones in mice.
22160269 2012 Regulation of tissue-specific expression of renal organic anion transporters by hepatocyte nuclear factor 1 ?/? and DNA methylation.
22060211 2012 Comprehensive molecular analysis of Japanese patients with pediatric-onset MODY-type diabetes mellitus.
22010049 2012 Loci affecting gamma-glutamyl transferase in adults and adolescents show age × SNP interaction and cardiometabolic disease associations.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21975049 2011 HNF1? inhibition triggers epithelial-mesenchymal transition in human liver cancer cell lines.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21814873 2011 A large multi-centre European study validates high-sensitivity C-reactive protein (hsCRP) as a clinical biomarker for the diagnosis of diabetes subtypes.
21747169 2011 Cell cycle-related kinase is a direct androgen receptor-regulated gene that drives ?-catenin/T cell factor-dependent hepatocarcinogenesis.
21683639 2011 Identification of HNF1A-MODY and HNF4A-MODY in Irish families: phenotypic characteristics and therapeutic implications.
21647738 2012 Genome-wide association with C-reactive protein levels in CLHNS: evidence for the CRP and HNF1A loci and their interaction with exposure to a pathogenic environment.
21573907 2011 Genome-wide association study of type 2 diabetes in a sample from Mexico City and a meta-analysis of a Mexican-American sample from Starr County, Texas.
21498636 2011 Genome-wide "pleiotropy scan" identifies HNF1A region as a novel pancreatic cancer susceptibility locus.
21454713 2011 Opposite regulation of the human apolipoprotein M gene by hepatocyte nuclear factor 1 and Jun transcription factors.
21437455 2011 New HNF-1? nonsense mutation causes maturity-onset diabetes of the young type 3.
21429061 2011 Obesity and type 2 diabetes mellitus in a birth cohort of First Nation children born to mothers with pediatric-onset type 2 diabetes.
21353246 2011 Hepatocyte nuclear factor 4? gene mutation associated with familial neonatal hyperinsulinism and maturity-onset diabetes of the young.
21348892 2011 The predominant expression of hepatocyte nuclear factor 4? (HNF4?) in thyroid transcription factor-1 (TTF-1)-negative pulmonary adenocarcinoma.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21224407 2011 Genetic and clinical characteristics of patients with HNF1A gene variations from the German-Austrian DPV database.
21208426 2011 HNF1A G319S variant, active cigarette smoking and incident type 2 diabetes in Aboriginal Canadians: a population-based epidemiological study.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
21196492 2011 Genome-wide association study for C-reactive protein levels identified pleiotropic associations in the IL6 locus.
21195701 2011 Effect of obesity on the association between common variations in the HNF1A gene region and C-reactive protein level in Taiwanese.
21182953 2011 Hepatic adenomas caused by somatic HNF1A mutations in children with biallelic mismatch repair gene mutations.
21170474 Differential effects of HNF-1? mutations associated with familial young-onset diabetes on target gene regulation.
21168233 2011 HNF1 alpha gene coding regions mutations screening, in a Caucasian population clinically characterized as MODY from Argentina.
21062467 2010 Effect of the rs2259816 polymorphism in the HNF1A gene on circulating levels of c-reactive protein and coronary artery disease (the ludwigshafen risk and cardiovascular health study).
20980261 2011 Inhibition of suppressive T cell factor 1 (TCF-1) isoforms in naive CD4+ T cells is mediated by IL-4/STAT6 signaling.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20863361 2010 Disease progression and search for monogenic diabetes among children with new onset type 1 diabetes negative for ICA, GAD- and IA-2 Antibodies.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20829431 2010 The human organic anion transporter genes OAT5 and OAT7 are transactivated by hepatocyte nuclear factor-1? (HNF-1?).
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
20727736 2011 C-reactive protein-associated genetic variants and cancer risk: findings from FINRISK 1992, FINRISK 1997 and Health 2000 studies.
20716378 2010 Assessing the association of the HNF1A G319S variant with C-reactive protein in Aboriginal Canadians: a population-based epidemiological study.
20705777 2010 Double heterozygous mutations involving both HNF1A/MODY3 and HNF4A/MODY1 genes: a case report.
20690076 2011 Maturity-Onset Diabetes of the Young (MODY) caused by a novel nonsense mutation E41X in the HNF-1? gene.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20648472 2010 PNPLA3 variants specifically confer increased risk for histologic nonalcoholic fatty liver disease but not metabolic disease.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20633866 2010 Mutations in the hepatocyte nuclear factor-1? (HNF1B) gene are common with combined uterine and renal malformations but are not found with isolated uterine malformations.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20568120 2010 HNF1? and CDX2 transcriptional factors bind to cadherin-17 (CDH17) gene promoter and modulate its expression in hepatocellular carcinoma.
20546258 2010 Increased all-cause and cardiovascular mortality in monogenic diabetes as a result of mutations in the HNF1A gene.
20460578 2010 HNF1alpha and SREBP2 are important regulators of NPC1L1 in human liver.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20396999 2010 Hepatocyte nuclear factor (HNF)-4alpha-driven epigenetic silencing of the human PED gene.
20394740 2010 Interaction of common sequence variants and selected risk factors in determination of HDL cholesterol levels.
20393147 2010 Spectrum of HNF1A somatic mutations in hepatocellular adenoma differs from that in patients with MODY3 and suggests genotoxic damage.
20172480 2010 Clinical differences between patients with MODY-3, MODY-2 and type 2 diabetes mellitus with I27L polymorphism in the HNF1alpha gene.
20133952 2010 Cooperation between HNF-1alpha, Cdx2, and GATA-4 in initiating an enterocytic differentiation program in a normal human intestinal epithelial progenitor cell line.
20132997 2010 Three novel mutations in MODY and its phenotype in three different Czech families.
20113359 2010 Associations between polymorphisms in five inflammation-related genes and cognitive ability in older persons.
20106981 2010 Distinct regulation of hepatic nuclear factor 1alpha by NKX6.1 in pancreatic beta cells.
20096102 2010 Regulation of UGT1A1 and HNF1 transcription factor gene expression by DNA methylation in colon cancer cells.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
20069546 2010 PSMD9 is linked to MODY3.
20031592 2009 Common coding variants of the HNF1A gene are associated with multiple cardiovascular risk phenotypes in community-based samples of younger and older European-American adults: the Coronary Artery Risk Development in Young Adults Study and The Cardiovascular Health Study.
20028982 2010 Interaction between Hhex and SOX13 modulates Wnt/TCF activity.
20018894 2010 MicroRNAs regulate human hepatocyte nuclear factor 4alpha, modulating the expression of metabolic enzymes and cell cycle.
19933992 2010 Evaluation of serum 1,5 anhydroglucitol levels as a clinical test to differentiate subtypes of diabetes.
19924231 2009 Species-specific differences in the expression of the HNF1A, HNF1B and HNF4A genes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19782160 Interaction of intestinal and pancreatic transcription factors in the regulation of CFTR gene expression.
19749792 2009 A Wnt kinase network alters nuclear localization of TCF-1 in colon cancer.
19741195 2009 Hepatocyte nuclear factor 1 is essential for transcription of sodium-dependent vitamin C transporter protein 1.
19687008 2009 Hepatocyte nuclear factor 1alpha plays a critical role in PCSK9 gene transcription and regulation by the natural hypocholesterolemic compound berberine.
19672314 2009 Low frequency variants in the exons only encoding isoform A of HNF1A do not contribute to susceptibility to type 2 diabetes.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19567438 2009 Genetic Loci associated with C-reactive protein levels and risk of coronary heart disease.
19564454 2009 Maturity-onset diabetes of the young in children with incidental hyperglycemia: a multicenter Italian study of 172 families.
19536331 2009 Positive reciprocal regulation of ubiquitin C-terminal hydrolase L1 and beta-catenin/TCF signaling.
19490620 2009 HNF1A gene polymorphisms and cardiovascular risk factors in individuals with late-onset autosomal dominant diabetes: a cross-sectional study.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19388975 2009 A genetic diagnosis of HNF1A diabetes alters treatment and improves glycaemic control in the majority of insulin-treated patients.
19357985 2009 Dominant-negative mutant hepatocyte nuclear factor 1alpha induces diabetes in transgenic-cloned pigs.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19349540 2009 Comprehensive pharmacogenetic analysis of irinotecan neutropenia and pharmacokinetics.
19336507 2009 Identification of novel variants in the hepatocyte nuclear factor-1alpha gene in South Indian patients with maturity onset diabetes of young.
19304666 2009 Specific expression and regulation of hepassocin in the liver and down-regulation of the correlation of HNF1alpha with decreased levels of hepassocin in human hepatocellular carcinoma.
19289501 2009 Hnf1alpha (MODY3) controls tissue-specific transcriptional programs and exerts opposed effects on cell growth in pancreatic islets and liver.
19280766 2009 Hepatic nuclear factor 1-alpha: inflammation, genetics, and atherosclerosis.
19264593 2009 Prospero-related homeobox protein (Prox1) inhibits hepatitis B virus replication through repressing multiple cis regulatory elements.
19228875 2009 A-beta-subtype of ketosis-prone diabetes is not predominantly a monogenic diabetic syndrome.
19198612 2009 New susceptibility locus for coronary artery disease on chromosome 3q22.3.
19188435 2009 Functional targets of the monogenic diabetes transcription factors HNF-1alpha and HNF-4alpha are highly conserved between mice and humans.
19169489 2008 HNF1alpha mutations are present in half of clinically defined MODY patients in South-Brazilian individuals.
19150152 2009 Novel mutations in GCK and HNF1A genes in Italian families with MODY phenotype.
19119252 2008 Hepatocyte nuclear factor 1-alpha mutation in normal glucose-tolerant subjects and early-onset type 2 diabetic patients.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
18854284 2008 Serum C-reactive protein at diagnosis and response to therapy is the most powerful factor predicting outcome of multiple myeloma treated with thalidomide/ anthracycline-based therapy.
18811724 2009 Mutations of maturity-onset diabetes of the young (MODY) genes in Thais with early-onset type 2 diabetes mellitus.
18777455 2008 The A98V single nucleotide polymorphism (SNP) in hepatic nuclear factor 1 alpha (HNF-1alpha) is associated with insulin sensitivity and beta-cell function.
18720549 2008 Unexpected discovery of 2 cases of hepatocyte nuclear factor 1alpha-mutated infracentimetic adenomatosis.
18672310 2008 Low prevalence of MODY2 and MODY3 mutations in Brazilian individuals with clinical MODY phenotype.
18671716 2008 Glucose regulation of dipeptidyl peptidase IV gene expression is mediated by hepatocyte nuclear factor-1alpha in epithelial intestinal cells.
18593771 2008 Reduced pancreatic volume in hepatocyte nuclear factor 1A-maturity-onset diabetes of the young.
18586913 2008 Diabetes susceptibility in the Canadian Oji-Cree population is moderated by abnormal mRNA processing of HNF1A G319S transcripts.
18513305 2008 Prevalence of HNF1A (MODY3) mutations in a Norwegian population (the HUNT2 Study).
18513302 2008 Can complement factors 5 and 8 and transthyretin be used as biomarkers for MODY 1 (HNF4A-MODY) and MODY 3 (HNF1A-MODY)?
18498634 2008 The genetic susceptibility to type 2 diabetes may be modulated by obesity status: implications for association studies.
18440731 2008 Transcriptional regulation of the fatty acid binding protein 2 (FABP2) gene by the hepatic nuclear factor 1 alpha (HNF-1alpha).
18439552 2008 Polymorphisms of the HNF1A gene encoding hepatocyte nuclear factor-1 alpha are associated with C-reactive protein.
18439548 2008 Loci related to metabolic-syndrome pathways including LEPR,HNF1A, IL6R, and GCKR associate with plasma C-reactive protein: the Women's Genome Health Study.
18433912 2008 A case of new mutation in maturity-onset diabetes of the young type 3 (MODY 3) responsive to a low dose of sulphonylurea.
18433021 2008 MicroRNA profiling in hepatocellular tumors is associated with clinical features and oncogene/tumor suppressor gene mutations.
18399756 2008 Expression of hepatocyte nuclear factor-1alpha mRNA in human anaplastic thyroid cancer cell lines and tumors.
18391435 2008 Crystallization of hepatocyte nuclear factor 4 alpha (HNF4 alpha) in complex with the HNF1 alpha promoter element.
18346225 2008 A concerted action of HNF4alpha and HNF1alpha links hepatitis B virus replication to hepatocyte differentiation.
18332101 2008 Common variants in maturity-onset diabetes of the young genes and future risk of type 2 diabetes.
18221440 2008 Triple diabetes: coexistence of type 1 diabetes mellitus and a novel mutation in the gene responsible for MODY3 in an overweight adolescent.
18172616 2008 Transcriptional regulation of human UGT1A1 gene expression through distal and proximal promoter motifs: implication of defects in the UGT1A1 gene promoter.
18080173 2008 HNF4alpha is a crucial modulator of the cholesterol-dependent regulation of NPC1L1.
18003757 2008 The type and the position of HNF1A mutation modulate age at diagnosis of diabetes in patients with maturity-onset diabetes of the young (MODY)-3.
17965524 2007 Hepatocyte nuclear factor 1 alpha and 4 alpha are factors involved in interindividual variability in the expression of UGT1A6 and UGT1A9 but not UGT1A1, UGT1A3 and UGT1A4 mRNA in human livers.
17937063 2007 Four novel mutations, including the first gross deletion in TCF1, identified in HNF-4alpha, GCK and TCF1 in patients with MODY in Israel.
17932728 2007 Hepatocyte nuclear factor 1 alpha is a factor responsible for the interindividual variation of OATP1B1 mRNA levels in adult Japanese livers.
17828387 2007 Partial and whole gene deletion mutations of the GCK and HNF1A genes in maturity-onset diabetes of the young.
17638895 2007 Fascin, a novel target of beta-catenin-TCF signaling, is expressed at the invasive front of human colon cancer.
17601994 2007 Variants of the transcription factor 7-like 2 (TCF7L2) gene are associated with type 2 diabetes in an African-American population enriched for nephropathy.
17573900 2007 Mutations in GCK and HNF-1alpha explain the majority of cases with clinical diagnosis of MODY in Spain.
17569132 2007 Genotype phenotype classification of hepatocellular adenoma.
17475670 2007 HNF-1alpha plays an important role in IL-6-induced expression of the human angiotensinogen gene.
17458140 2007 Association of a common haplotype of hepatocyte nuclear factor 1alpha with type 2 diabetes in Chinese population.
17440429 2008 Hepatocyte nuclear factor-1 alpha is associated with UGT1A1, UGT1A9 and UGT2B7 mRNA expression in human liver.
17440016 2007 Etiology of early-onset type 2 diabetes in Indians: islet autoimmunity and mutations in hepatocyte nuclear factor 1alpha and mitochondrial gene.
17407072 2007 [The genetic and clinical characteristics of transcription factor 1 gene mutations in Chinese diabetes].
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17327436 2007 Evaluation of common variants in the six known maturity-onset diabetes of the young (MODY) genes for association with type 2 diabetes.
17264800 2007 Hepatocyte nuclear factor1 transcription factors are essential for the UDP-glucuronosyltransferase 1A9 promoter response to hepatocyte nuclear factor 4alpha.
17194452 2007 HNF-1alpha participates in glucose regulation of sucrase-isomaltase gene expression in epithelial intestinal cells.
17192490 2007 Screening of 134 single nucleotide polymorphisms (SNPs) previously associated with type 2 diabetes replicates association with 12 SNPs in nine genes.
17130528 2006 Genetics of fulminant type 1 diabetes.
17116178 2006 HNF-1alpha G574S is a functional variant with decreased transactivation activity.
17049664 2006 Hepatocellular adenoma displaying a HNF1alpha inactivation in a patient with familial adenomatous polyposis coli.
17037983 2007 Regulation of the human mucin MUC4 by taurodeoxycholic and taurochenodeoxycholic bile acids in oesophageal cancer cells is mediated by hepatocyte nuclear factor 1alpha.
17033837 2006 Common variants in HNF-1 alpha and risk of type 2 diabetes.
17021248 2007 Repression of human GSTA1 by interleukin-1beta is mediated by variant hepatic nuclear factor-1C.
16963153 2007 GCK and HNF1alpha mutations and polymorphisms in Polish women with gestational diabetes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16930618 2006 Diabetes mellitus due to misfolding of a beta-cell transcription factor: stereospecific frustration of a Schellman motif in HNF-1alpha.
16893891 2006 Transcriptional regulation of the glucose-6-phosphatase gene by cAMP/vasoactive intestinal peptide in the intestine. Role of HNF4alpha, CREM, HNF1alpha, and C/EBPalpha.
16873704 2006 Association studies of variants in the genes involved in pancreatic beta-cell function in type 2 diabetes in Japanese subjects.
16793932 2006 Regulation of the expression of human organic anion transporter 3 by hepatocyte nuclear factor 1alpha/beta and DNA methylation.
16788384 2006 The caudal-related homeodomain protein Cdx2 and hepatocyte nuclear factor 1alpha cooperatively regulate the UDP-glucuronosyltransferase 2B7 gene promoter.
16781669 2006 Mutant HNF-1alpha and mutant HNF-1beta identified in MODY3 and MODY5 downregulate DPP-IV gene expression in Caco-2 cells.
16760222 2006 Isomers of the TCF1 gene encoding hepatocyte nuclear factor-1 alpha show differential expression in the pancreas and define the relationship between mutation position and clinical phenotype in monogenic diabetes.
16752173 2006 Common variants in MODY genes increase the risk of gestational diabetes mellitus.
16714285 2006 NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF).
16712787 2006 STMN2 is a novel target of beta-catenin/TCF-mediated transcription in human hepatoma cells.
16675441 2006 Distant HNF1 site as a master control for the human class I alcohol dehydrogenase gene expression.
16632067 2006 Genetic and clinical characteristics of Korean maturity-onset diabetes of the young (MODY) patients.
16562587 2006 Molecular genetic analysis of MODY candidate genes in Japanese patients with non-obese juvenile onset diabetes mellitus.
16541075 2006 The finished DNA sequence of human chromosome 12.
16443774 2006 Contrasting insulin sensitivity of endogenous glucose production rate in subjects with hepatocyte nuclear factor-1beta and -1alpha mutations.
16442529 2006 Bcr interferes with beta-catenin-Tcf1 interaction.
16367885 2006 IRS1, KCNJ11, PPARgamma2 and HNF-1alpha: do amino acid polymorphisms in these candidate genes support a shared aetiology between type 1 and type 2 diabetes?
16341674 2005 Transcriptome analysis of human gastric cancer.
16297991 2005 Identification of target genes of the transcription factor HNF1beta and HNF1alpha in a human embryonic kidney cell line.
16276364 2006 Clinical and genetic associations with hypertriglyceridemic waist in a Canadian aboriginal population.
16254374 2005 Novel type of hepatitis B virus mutation: replacement mutation involving a hepatocyte nuclear factor 1 binding site tandem repeat in chronic hepatitis B virus genotype E.
16249556 2005 Renal malformations may be linked to mutations in the hepatocyte nuclear factor-1alpha (MODY3) gene.
16241915 2005 Synergism between mutant HNF1A and the metabolic syndrome in Oji-Cree Type 2 diabetes.
16223942 2006 Mechanisms of mutual functional interactions between HNF-4alpha and HNF-1alpha revealed by mutations that cause maturity onset diabetes of the young.
16186275 2005 A prevalent amino acid polymorphism at codon 98 (Ala98Val) of the hepatocyte nuclear factor-1alpha is associated with maturity-onset diabetes of the young and younger age at onset of type 2 diabetes in Asian Indians.
16046319 2005 A large-scale association analysis of common variation of the HNF1alpha gene with type 2 diabetes in the U.K. Caucasian population.
16046299 2005 Association of common variation in the HNF1alpha gene region with risk of type 2 diabetes.
15983330 2005 Beta-cell dysfunction, insulin sensitivity, and glycosuria precede diabetes in hepatocyte nuclear factor-1alpha mutation carriers.
15983230 2005 Polymorphisms in the SLC2A2 (GLUT2) gene are associated with the conversion from impaired glucose tolerance to type 2 diabetes: the Finnish Diabetes Prevention Study.
15961790 2005 Control of ACAT2 liver expression by HNF1.
15930087 2006 Mutations in hepatocyte nuclear factor-1beta and their related phenotypes.
15928245 2005 Half of clinically defined maturity-onset diabetes of the young patients in Denmark do not have mutations in HNF4A, GCK, and TCF1.
15899904 2005 Prostaglandin E2 Stimulates the beta-catenin/T cell factor-dependent transcription in colon cancer.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
15841481 2005 Identification of novel GCK and HNF1A/TCF1 mutations and polymorphisms in German families with maturity-onset diabetes of the young (MODY).
15830177 2005 Molecular genetics and phenotypic characteristics of MODY caused by hepatocyte nuclear factor 4alpha mutations in a large European collection.
15740590 2005 In vivo and in vitro evidence for autocrine DCoH/HNF-1alpha transcription of albumin in the human epidermis.
15660729 2005 Clinical characteristics, beta-cell function, HLA class II and mutations in MODY genes in non-paediatric subjects with Type 1 diabetes without pancreatic autoantibodies.
15660195 2004 Scanning for MODY5 gene mutations in Chinese early onset or multiple affected diabetes pedigrees.
15569134 2004 Studies of the Ala/Val98 polymorphism of the hepatocyte nuclear factor-1alpha gene and the relationship to beta-cell function during an OGTT in glucose-tolerant women with and without previous gestational diabetes mellitus.
15542842 2004 Ternary complex factor-serum response factor complex-regulated gene activity is required for cellular proliferation and inhibition of apoptotic cell death.
15522234 2004 Effect of mutations in HNF-1alpha and HNF-1beta on the transcriptional regulation of human sucrase-isomaltase in Caco-2 cells.
15520459 2004 Pattern of genes influenced by conditional expression of the transcription factors HNF6, HNF4alpha and HNF1beta in a pancreatic beta-cell line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355349 2004 The HNF1beta transcription factor has several domains involved in nephrogenesis and partially rescues Pax8/lim1-induced kidney malformations.
15326484 2004 Mutation of TCF1 encoding hepatocyte nuclear factor 1alpha in gynecological cancer.
15305805 2004 Spectrum of HNF1A and GCK mutations in Canadian families with maturity-onset diabetes of the young (MODY).
15300627 2004 [Scanning HNF-1 alpha gene mutation in Chinese early-onset and/or multiplex diabetes pedigrees].
15277395 2004 Polymorphic variations in the neurogenic differentiation-1, neurogenin-3, and hepatocyte nuclear factor-1alpha genes contribute to glucose intolerance in a South Indian population.
15270800 2004 Serum amino acids in patients with mutations in the hepatocyte nuclear factor-1 alpha gene.
15217781 2004 Control of differentiation-induced calbindin-D9k gene expression in Caco-2 cells by cdx-2 and HNF-1alpha.
15194767 2004 Regulation of hepatitis B virus core promoter by transcription factors HNF1 and HNF4 and the viral X protein.
15111528 2004 Contrasting diabetes phenotypes associated with hepatocyte nuclear factor-1alpha and -1beta mutations.
14988562 2004 Control of pancreas and liver gene expression by HNF transcription factors.
14747304 2004 Messenger RNA transcripts of the hepatocyte nuclear factor-1alpha gene containing premature termination codons are subject to nonsense-mediated decay.
14728801 2003 LRH-1/hB1F and HNF1 synergistically up-regulate hepatitis B virus gene transcription and DNA replication.
14715527 2004 GATA-4, GATA-5, and GATA-6 activate the rat liver fatty acid binding protein gene in concert with HNF-1alpha.
14583183 Genetic variants of hepatocyte nuclear factor-1beta in Chinese young-onset diabetic patients with nephropathy.
14575719 2003 HNF1alpha upregulates the human AE2 anion exchanger gene (SLC4A2) from an alternate promoter.
14500717 2003 Serine/threonine kinase Mirk/Dyrk1B is an inhibitor of epithelial cell migration and is negatively regulated by the Met adaptor Ran-binding protein M.
12934344 2003 [Relationship between Ala98Val variant of hepatocyte nuclear factor-1 alpha gene and late-onset type 2 diabetes in Han nationality].
12860991 2003 Functions of HNF1 family members in differentiation of the visceral endoderm cell lineage.
12794133 2003 Hepatocyte NF-1 and STAT6 cooperate with additional DNA-binding factors to activate transcription of the human polymeric Ig receptor gene in response to IL-4.
12788852 2003 Association of I27L polymorphism of hepatocyte nuclear factor-1 alpha gene with high-density lipoprotein cholesterol level.
12773136 2003 Comparison of the impact of the I27L polymorphism of the hepatocyte nuclear factor-1alpha on estimated and measured beta cell indices.
12762846 2003 Combining genome and mouse knockout expression data to highlight binding sites for the transcription factor HNF1alpha.
12743700 2003 The polymorphism Gly574Ser in the transcription factor HNF-1alpha is not a marker of adult-onset ketosis-prone atypical diabetes in Afro-Caribbean patients.
12730871 2003 Frequent mutations of hepatocyte nuclear factor 1 in colorectal cancer with microsatellite instability.
12726923 2003 Genes, environment and Oji-Cree type 2 diabetes.
12712243 2003 Identification and functional characterization of a novel mutation of hepatocyte nuclear factor-1alpha gene in a Korean family with MODY3.
12707037 2003 Loss of expression of the WNT/beta-catenin-signaling pathway transcription factors lymphoid enhancer factor-1 (LEF-1) and T cell factor-1 (TCF-1) in a subset of peripheral T cell lymphomas.
12627330 2003 Genetic epidemiology of MODY in the Czech republic: new mutations in the MODY genes HNF-4alpha, GCK and HNF-1alpha.
12605834 2003 [Clinical, metabolic, immunologic and genotypic characteristics in non-pediatric patients with type 1A diabetes mellitus. Onset and short-term prognosis].
12574234 2003 Hepatocyte nuclear factor-1 alpha gene mutations and diabetes in Norway.
12565907 2003 In situ and in vitro evidence for DCoH/HNF-1 alpha transcription of tyrosinase in human skin melanocytes.
12547858 2003 Identifying hepatic nuclear factor 1alpha mutations in children and young adults with a clinical diagnosis of type 1 diabetes.
12544512 2003 Hepatocyte nuclear factor-4 alpha/gamma and hepatocyte nuclear factor-1 alpha as causal factors of interindividual difference in the expression of human dihydrodiol dehydrogenase 4 mRNA in human livers.
12530534 2002 Evidence for haploinsufficiency of the human HNF1alpha gene revealed by functional characterization of MODY3-associated mutations.
12488962 2002 Identification of three new mutations of the HNF-1 alpha gene in Japanese MODY families.
12488961 2002 High frequency of mutations in the HNF-1alpha gene in non-obese patients with diabetes of youth in Japanese and identification of a case of digenic inheritance.
12488960 2002 Characterization of a naturally occurring mutation (L107I) in the HNF1 alpha (MODY3) gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453976 2002 Determinants of the development of diabetes (maturity-onset diabetes of the young-3) in carriers of HNF-1alpha mutations: evidence for parent-of-origin effect.
12453975 2002 Intrauterine hyperglycemia is associated with an earlier diagnosis of diabetes in HNF-1alpha gene mutation carriers.
12453961 2002 The prevalence of the HNF-1alpha G319S mutation in Canadian aboriginal youth with type 2 diabetes.
12453420 2002 Diabetes mutations delineate an atypical POU domain in HNF-1alpha.
12442280 2002 GCK and HNF1A mutations in Canadian families with maturity onset diabetes of the young (MODY).
12378390 2002 Abnormal splicing of hepatocyte nuclear factor 1 alpha in maturity-onset diabetes of the young.
12355088 2002 Bi-allelic inactivation of TCF1 in hepatic adenomas.
12235114 2002 Genetic evidence that HNF-1alpha-dependent transcriptional control of HNF-4alpha is essential for human pancreatic beta cell function.
12107757 2002 Mutations in the hepatocyte nuclear factor-1alpha gene in Chinese MODY families: prevalence and functional analysis.
12107263 2002 Aberrant localization of beta-catenin correlates with overexpression of its target gene in human papillary thyroid cancer.
12050210 2002 Nine novel mutations in maturity-onset diabetes of the young (MODY) candidate genes in 22 Spanish families.
12012276 2002 Mutations and intronic variants in the HNF-1 beta gene in a group of German and Czech Caucasians with type 2 diabetes mellitus and progressive diabetic nephropathy.
12011060 2002 Physical interaction between GATA-5 and hepatocyte nuclear factor-1alpha results in synergistic activation of the human lactase-phlorizin hydrolase promoter.
11980910 2002 Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha.
11978637 2002 Hepatocyte nuclear factor-1alpha recruits the transcriptional co-activator p300 on the GLUT2 gene promoter.
11772903 2002 Screening for MODY mutations, GAD antibodies, and type 1 diabetes--associated HLA genotypes in women with gestational diabetes mellitus.
11522670 2001 The generalized aminoaciduria seen in patients with hepatocyte nuclear factor-1alpha mutations is a feature of all patients with diabetes and is associated with glucosuria.
11440371 2001 Routine mutation screening of HNF-1alpha and GCK genes in MODY diagnosis: how effective are the techniques of DHPLC and direct sequencing used in combination?
11269503 2000 HNF1alpha controls renal glucose reabsorption in mouse and man.
11266540 2001 All Tcf HMG box transcription factors interact with Groucho-related co-repressors.
11162430 2000 MODY associated with two novel hepatocyte nuclear factor-1alpha loss-of-function mutations (P112L and Q466X).
11134330 2001 Interleukin-6-induced STAT3 and AP-1 amplify hepatocyte nuclear factor 1-mediated transactivation of hepatic genes, an adaptive response to liver injury.
10966642 2000 Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
10944108 2000 Molecular targets of a human HNF1 alpha mutation responsible for pancreatic beta-cell dysfunction.
10779377 2000 Octamer transcription factor-1 enhances hepatic nuclear factor-1alpha-mediated activation of the human UDP glucuronosyltransferase 2B7 promoter.
10777539 2000 Transcriptional activation by hepatocyte nuclear factor-1 requires synergism between multiple coactivator proteins.
10677375 2000 Interaction between the homeodomain proteins Cdx2 and HNF1alpha mediates expression of the lactase-phlorizin hydrolase gene.
10649494 2000 Identification of seven novel nucleotide variants in the hepatocyte nuclear factor-1alpha (TCF1) promoter region in MODY patients.
10588527 1999 Molecular genetics of diabetes mellitus in Chinese subjects: identification of mutations in glucokinase and hepatocyte nuclear factor-1alpha genes in patients with early-onset type 2 diabetes mellitus/MODY.
10482964 1999 Non-penetrance in a MODY 3 family with a mutation in the hepatic nuclear factor 1alpha gene: implications for predictive testing.
10333057 1999 Three new mutations in the hepatocyte nuclear factor-1alpha gene in Japanese subjects with diabetes mellitus: clinical features and functional characterization.
10330009 1999 Regulation of alpha1-antitrypsin gene expression in human intestinal epithelial cell line caco-2 by HNF-1alpha and HNF-4.
10209158 1999 Regulation of LEF-1/TCF transcription factors by Wnt and other signals.
10102714 1999 Allelic drop-out in exon 2 of the hepatocyte nuclear factor-1alpha gene hinders the identification of mutations in three families with maturity-onset diabetes of the young.
10084598 1999 The hepatic nuclear factor-1alpha G319S variant is associated with early-onset type 2 diabetes in Canadian Oji-Cree.
10078571 1999 Identification of mutations in the hepatocyte nuclear factor-1alpha gene in Japanese subjects with early-onset NIDDM and functional analysis of the mutant proteins.
9867222 1998 Mutations in the hepatocyte nuclear factor-1alpha gene in Caucasian families originally classified as having Type I diabetes.
9792724 1998 Retinoic acid mediates down-regulation of the alpha-fetoprotein gene through decreased expression of hepatocyte nuclear factors.
9754819 1998 Mutation screening in 18 Caucasian families suggest the existence of other MODY genes.
9626139 1998 Linkage and molecular scanning analyses of MODY3/hepatocyte nuclear factor-1 alpha gene in typical familial type 2 diabetes: evidence for novel mutations in exons 8 and 10.
9621514 1998 Mutations in the hepatocyte nuclear factor-1 alpha gene (MODY3) are not a major cause of early-onset non-insulin-dependent (type 2) diabetes mellitus in Japanese.
9604876 1998 Hepatocyte nuclear factor 1alpha coding mutations are an uncommon contributor to early-onset type 2 diabetes in Ashkenazi Jews.
9439666 1997 A rapid screening method for hepatocyte nuclear factor 1 alpha frameshift mutations; prevalence in maturity-onset diabetes of the young and late-onset non-insulin dependent diabetes.
9392505 1997 An automated fluorescent single-strand conformation polymorphism technique for screening mutations in the hepatocyte nuclear factor-1alpha gene (maturity-onset diabetes of the young).
9313764 1997 Maturity-onset diabetes of the young due to a mutation in the hepatocyte nuclear factor-4 alpha binding site in the promoter of the hepatocyte nuclear factor-1 alpha gene.
9313763 1997 Identification of mutations in the hepatocyte nuclear factor (HNF)-1 alpha gene in Japanese subjects with IDDM.
9287055 1997 Mutations in the hepatocyte nuclear factor-1alpha gene (MODY3) are not a major cause of late-onset NIDDM in Japanese subjects.
9287053 1997 Mutations in the hepatocyte nuclear factor-1alpha/MODY3 gene in Japanese subjects with early- and late-onset NIDDM.
9166684 1997 Novel mutations and a mutational hotspot in the MODY3 gene.
9133564 1997 A prevalent amino acid polymorphism at codon 98 in the hepatocyte nuclear factor-1alpha gene is associated with reduced serum C-peptide and insulin responses to an oral glucose challenge.
9112026 1997 Genetic variation in the hepatocyte nuclear factor-1 alpha gene in Danish Caucasians with late-onset NIDDM.
9097962 1997 Identification of nine novel mutations in the hepatocyte nuclear factor 1 alpha gene associated with maturity-onset diabetes of the young (MODY3).
9092652 1997 The bifunctional DCOH protein binds to HNF1 independently of its 4-alpha-carbinolamine dehydratase activity.
9075819 1997 Novel MODY3 mutations in the hepatocyte nuclear factor-1alpha gene: evidence for a hyperexcitability of pancreatic beta-cells to intravenous secretagogues in a glucose-tolerant carrier of a P447L mutation.
9075818 1997 Mutations in the hepatocyte nuclear factor-1alpha gene are a common cause of maturity-onset diabetes of the young in the U.K.
9032114 1997 Mutations in the hepatocyte nuclear factor-1alpha gene in MODY and early-onset NIDDM: evidence for a mutational hotspot in exon 4.
8945470 1996 Mutations in the hepatocyte nuclear factor-1alpha gene in maturity-onset diabetes of the young (MODY3)
8288579 1994 The transcription factor HNF1 acts with C/EBP alpha to synergistically activate the human albumin promoter through a novel domain.
7900999 1993 More potent transcriptional activators or a transdominant inhibitor of the HNF1 homeoprotein family are generated by alternative RNA processing.
7795649 1995 A gene for maturity onset diabetes of the young (MODY) maps to chromosome 12q.
2460858 1988 Purified hepatocyte nuclear factor 1 interacts with a family of hepatocyte-specific promoters.
2263635 1990 Molecular cloning, functional expression, and chromosomal localization of mouse hepatocyte nuclear factor 1.
2044952 1991 HNF-1 alpha and HNF-1 beta (vHNF-1) share dimerization and homeo domains, but not activation domains, and form heterodimers in vitro.
1707031 1990 Cloning of human hepatic nuclear factor 1 (HNF1) and chromosomal localization of its gene in man and mouse.
1677179 1991 Two members of an HNF1 homeoprotein family are expressed in human liver.
1535333 1992 Chromosomal localization in man and rat of the genes encoding the liver-enriched transcription factors C/EBP, DBP, and HNF1/LFB-1 (CEBP, DBP, and transcription factor 1, TCF1, respectively) and of the hepatocyte growth factor/scatter factor gene (HGF).