Property Summary

NCBI Gene PubMed Count 59
PubMed Score 954.02
PubTator Score 476.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.100 7.7e-06
psoriasis 1.900 5.9e-05
medulloblastoma -1.200 1.5e-06
pancreatic ductal adenocarcinoma liver m... -1.548 1.0e-02
adult high grade glioma -1.200 3.2e-05
subependymal giant cell astrocytoma -1.413 2.9e-02
gastric carcinoma -1.100 1.2e-02

 IMPC Phenotype (1)

Protein-protein Interaction (12)

Gene RIF (42)

PMID Text
26781569 HMOX2 contributes to high-altitude adaptation in Tibetans by functioning as a modifier in the regulation of hemoglobin metabolism.
26652036 The same mechanism of heme hydroxylation to alpha-meso-hydroxyheme is employed by both isoforms HO-1 and HO-2.
26091465 a weak association between HMOX2 rs1051308 polymorphisms and the risk to develop essential tremor in the Spanish population.
25864768 HO-2 protein is expressed in the cytosols of skin cancer cells.
25849895 Taken together with EPR measurements, which show the appearance of a new low-spin heme signal in reduced HO2, it appears that a cysteine residue(s) in the HRMs directly interacts with a second bound heme
25196843 Interactions of HO-2 with CPR and BVR, were evaluated.
23792437 We believe that a dysfunctional HO-ferritin system leads to increased levels of proinflammatory mediators, thus contributing to the inflammation characteristic of pterygia.
22935040 increased expression of nucleated RBC, HSP90alpha and corresponding decreased expression of HO-2 in such hypoxic condition may play a protective role; to prevent cord blood RBC against stress induced damage during preeclampsia.
22923613 Role of cysteine residues in heme binding to human heme oxygenase-2 elucidated by two-dimensional NMR spectroscopy.
22892400 PFKFB4 and HO-2 are expressed in a coordinated manner to maintain glucose homeostasis.
22559824 HO-1 and HO-2 contribute little in the pathophysiology of adenomyosis.
22545110 Although the carboxy-terminal deletion mutant of HO-2 is found in the nucleus, translocation of HO-2 to the nucleus does not occur under conditions of hypoxia.
21804464 Results suggest that the c.544G>A polymorphism of the heme oxygenase-2 gene is not associated with age-related macular degeneration in this population.
21765894 Erythroid precursors were characterized by lack of significant expression of HO-1 and by progressive reduction of HO-2 during differentiation.
21709601 for the first time, copy number variations in the HMOX2 gene and an association of the SNP rs2270363 with Parkinson's disease risk.
21647550 The 19G>C-HMOX1 and the -42 + 1444A>G-HMOX2 polymorphisms may be associated with the occurrence and progression of age-related macular degeneration.
21506105 HO-2, which is highly expressed in the corneal epithelium, appears to be critical for the wound healing process in the cornea.
21044367 Observational study of gene-disease association. (HuGE Navigator)
20629646 There was positive correlation between seminal plasma HO enzyme activity and sperm concentration, per cent of motile spermatozoa, number of motile spermatozoas ml(-1) and significant negative correlation with per cent of sperm abnormal forms.
20502928 These findings are consistent with the presence of a hydrogen-bonding network at the heme's distal side within the active site of HO-2 with potentially significant differences from that observed in HO-1.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20118244 HO-2 is important in maintaining endothelial viability and may preserve local regulation of vascular tone, thrombosis, and inflammatory responses during reductions in systemic oxygen delivery
19886851 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19874887 high expression in keratinocytes prevents basal and radiation-induced gene expression of heme oxygenase 1
19473966 The thiol/disulfide switch in HO-2 responds to cellular oxidative stress and reductive conditions, representing a paradigm for how heme regulatory motifs can integrate heme homeostasis with carbon monoxide signaling and redox regulation.
19399816 Enhanced oxidative stress and a decrease in the number of anti-oxidant enzymes may be associated with pre-eclampsia.
19345412 HO-2 may be important in controlling trophoblast invasion.
19246912 Our study failed to detect any association between the single nucleotide polymorphisms of the HMOX1 gene and Alzheimer's disease
19246912 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
17965015 analysis of apo- and heme-bound crystal structures of a truncated human heme oxygenase-2
17601350 Observational study of gene-disease association. (HuGE Navigator)
17540772 the heme regulatory motifs in HO-2 constitute a thiol/disulfide redox switch that regulates the myriad physiological functions of HO-2, including its involvement in the hypoxic response in the carotid body
17510199 Suggest membrane potential gradient in small intestine is dependent on carbon monoxide generated by HO-2 in interstital cells of Cajal.
17064313 These results suggest that HO-2 may down-regulate the expression of HO-1, thereby directing the co-ordinated expression of HO-1 and HO-2.
16137652 Review summarizes function of hemoxygenase-2 as an oxygen sensor of native and recombinant large conductance, voltage- and calcium-dependent potassium BK(Ca) channels expressed in carotid body glomus cells.
16043027 Catalytically inactive mutant, HO-2H45A, overexpressed in HEK293 cell lines was more sensitive to hemin as compared to control. HO-2H45A was also able to protect cells against oxidative stress injury.
15528406 HO-2 is part of the BK channel complex and enhances channel activity in normoxia
14615405 regulation of HO expression in the human placenta is a complex process that depends, at least in part, on local glucose and oxygen concentrations.
14506930 Low expression of HO-2 may lead to enhanced levels of free heme at the feto-maternal interface, with subsequent upregulation of adhesion molecules, allowing enhanced inflammatory cells migration to the feto-maternal interface.
12775419 Genes, including GABRP, ADF, HINT, PRSS2, SDCBP, PTK9, PPP2R5B, ITGA3, PRKCBP1, HMOX2, HAT1, PPP1cB, and ICAM-1, are upregulated after treatment of human astrocytes with HIV-1 gp120
12578814 HO-2 protein content was decreased by 17% and 5% in human trophoblast cells after 24-h exposure to 1% and 5% O(2), respectively, versus 20% O(2) but unchanged in chorionic villi

AA Sequence

MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA      1 - 70
TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY     71 - 140
IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD    141 - 210
LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS    211 - 280
SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM                                      281 - 316
//

Text Mined References (65)

PMID Year Title
26781569 2016 HMOX2 Functions as a Modifier Gene for High-Altitude Adaptation in Tibetans.
26652036 2016 Comparison of the Mechanisms of Heme Hydroxylation by Heme Oxygenases-1 and -2: Kinetic and Cryoreduction Studies.
26091465 2015 Heme Oxygenase 1 and 2 Common Genetic Variants and Risk for Essential Tremor.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25864768 The heme oxygenase/biliverdin reductase system in skin cancers.
25849895 2015 Spectroscopic studies reveal that the heme regulatory motifs of heme oxygenase-2 are dynamically disordered and exhibit redox-dependent interaction with heme.
25196843 2014 Protein/protein interactions in the mammalian heme degradation pathway: heme oxygenase-2, cytochrome P450 reductase, and biliverdin reductase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23792437 2013 Dysregulated heme oxygenase-ferritin system in pterygium pathogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22935040 2013 Differential expression of HSP90? and heme oxygenase in cord blood RBC during preeclampsia.
22923613 2012 Role of cysteine residues in heme binding to human heme oxygenase-2 elucidated by two-dimensional NMR spectroscopy.
22892400 2012 Coordinated expression of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 and heme oxygenase 2: evidence for a regulatory link between glycolysis and heme catabolism.
22559824 2012 Expression of heme oxygenase in the eutopic and ectopic endometrium in patients with adenomyosis.
22545110 2012 Heme oxygenase isoforms differ in their subcellular trafficking during hypoxia and are differentially modulated by cytochrome P450 reductase.
21804464 2011 Lack of association between the c.544G>A polymorphism of the heme oxygenase-2 gene and age-related macular degeneration.
21765894 2011 Heme-oxygenases during erythropoiesis in K562 and human bone marrow cells.
21709601 2011 A polymorphism located at an ATG transcription start site of the heme oxygenase-2 gene is associated with classical Parkinson's disease.
21647550 2012 An association between polymorphism of the heme oxygenase-1 and -2 genes and age-related macular degeneration.
21506105 2011 Knockdown of heme oxygenase-2 impairs corneal epithelial cell wound healing.
21269460 2011 Initial characterization of the human central proteome.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20629646 2010 Heme oxygenase enzyme activity in seminal plasma of oligoasthenoteratozoospermic males with varicocele.
20502928 2010 Spectroscopic insights into axial ligation and active-site H-bonding in substrate-bound human heme oxygenase-2.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20118244 2010 Enhanced translation of heme oxygenase-2 preserves human endothelial cell viability during hypoxia.
19946888 2010 Defining the membrane proteome of NK cells.
19886851 2009 Association of an intronic variant of the heme oxygenase-1 gene with hypertension in northern Chinese Han population.
19874887 2010 A role for Bach1 and HO-2 in suppression of basal and UVA-induced HO-1 expression in human keratinocytes.
19473966 2009 Heme regulatory motifs in heme oxygenase-2 form a thiol/disulfide redox switch that responds to the cellular redox state.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19399816 2009 Cellular mRNA expressions of anti-oxidant factors in the blood of preeclamptic women.
19345412 2009 Inhibitors of heme oxygenase reduce invasion of human primary cytotrophoblast cells in vitro.
19246912 2009 No genetic association between polymorphisms of heme oxygenase 1 and 2 and Alzheimer's disease in a Japanese population.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
17965015 2007 Comparison of apo- and heme-bound crystal structures of a truncated human heme oxygenase-2.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17540772 2007 Evidence that the heme regulatory motifs in heme oxygenase-2 serve as a thiol/disulfide redox switch regulating heme binding.
17510199 2007 Membrane potential gradient is carbon monoxide-dependent in mouse and human small intestine.
17064313 2006 Down-regulation of heme oxygenase-2 is associated with the increased expression of heme oxygenase-1 in human cell lines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16137652 2005 Hemeoxygenase-2 as an O2 sensor in K+ channel-dependent chemotransduction.
16043027 2005 Catalytically inactive heme oxygenase-2 mutant is cytoprotective.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15528406 2004 Hemoxygenase-2 is an oxygen sensor for a calcium-sensitive potassium channel.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615405 2003 Effect of glucose and oxygen deprivation on heme oxygenase expression in human chorionic villi explants and immortalized trophoblast cells.
14527438 2003 Carbon monoxide neurotransmission activated by CK2 phosphorylation of heme oxygenase-2.
14506930 2003 Heme oxygenases in pregnancy II: HO-2 is downregulated in human pathologic pregnancies.
12909459 2003 Heme oxygenase-1: unleashing the protective properties of heme.
12578814 2003 Effects of hypoxia on heme oxygenase expression in human chorionic villi explants and immortalized trophoblast cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12057765 2002 Decreased activity of the antioxidant heme oxygenase enzyme: implications in ischemia and in Alzheimer's disease.
11572959 2001 Neural roles for heme oxygenase: contrasts to nitric oxide synthase.
11171041 2001 Haem oxygenase-1: a novel player in cutaneous wound repair and psoriasis?
11027601 2000 Expression and localization of heme oxygenase in human placental villi.
9284910 1997 Assignment of the mouse heme oxygenase genes: heme oxygenase-1 (Hmox1) to chromosome 10 band C1 and heme oxygenase-2 (Hmox2) to chromosome 16 band B1.
8764571 1996 Expression of heme oxygenase isozyme mRNAs in the human brain and induction of heme oxygenase-1 by nitric oxide donors.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8034330 1994 Chromosomal localization of the human heme oxygenase genes: heme oxygenase-1 (HMOX1) maps to chromosome 22q12 and heme oxygenase-2 (HMOX2) maps to chromosome 16p13.3.
7890772 1995 Heme oxygenase-2. Properties of the heme complex of the purified tryptic fragment of recombinant human heme oxygenase-2.
1575508 1992 Human heme oxygenase-2: characterization and expression of a full-length cDNA and evidence suggesting that the two HO-2 transcripts may differ by choice of polyadenylation signal.