Property Summary

NCBI Gene PubMed Count 826
PubMed Score 5707.94
PubTator Score 2639.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -2.600 3.7e-08
psoriasis 1.400 1.4e-07
glioblastoma 2.600 4.6e-03
posterior fossa group A ependymoma 1.700 3.6e-05
cystic fibrosis 1.682 1.3e-06
acute quadriplegic myopathy 1.156 3.6e-05
pancreatic ductal adenocarcinoma liver m... -2.163 3.1e-03
non-small cell lung cancer -1.621 4.3e-10
lung cancer -1.200 5.5e-04
active Crohn's disease -1.200 2.8e-02
interstitial cystitis 1.800 6.4e-05
pediatric high grade glioma 2.200 1.2e-04
pilocytic astrocytoma 1.300 4.9e-04
aldosterone-producing adenoma -1.283 3.5e-02
subependymal giant cell astrocytoma 2.408 8.1e-03
inflammatory breast cancer 2.200 1.8e-04
lung carcinoma -1.200 2.5e-13
ulcerative colitis -1.700 9.2e-06
ovarian cancer -1.200 7.5e-05

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (856)

PMID Text
27058954 evaluated Abeta-induced DNA methylation status of HMOX1 at -374 promoter CpG site in blood samples from Alzheimer disease patients, patients with mild cognitive impairment, and control individuals
27023064 These data suggest the role of Nrf2, HO-1 and glutathione as molecular targets to improve the efficacy of low doses of bortezomib in the treatment of malignant neuroblastoma.
26898422 HO-1, which is involved in the development of chemoresistance in leukemia cells by regulating autophagy, may be a novel target for improving leukemia therapy.
26822586 HO-1 inhibitor, ZnPP, possessed the properties of anti-tumor agent by decreasing HIF-1alpha levels, blocking VEGF production, impairing tumor angiogenesis, and inhibiting tumor growth.
26782424 Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine.
26777482 overexpression in pig islets prolongs islet xenograft survival
26726846 High HO-1 expression was associated with poor prognosis of cholangiocarcinoma.
26700310 interleukin-6 and heme oxygenase-1 are involved in resistance to lenalidomide in multiple myeloma cells
26697129 This review focuses on the Nrf2/HO-1 stress response mechanism as a promising target for anticancer treatment which is able to overcome resistance to therapies.
26690352 HLA I Ab-dependent EC activation is modulated by endothelial HO-1 and targeted induction of this enzyme may be a novel therapeutic approach for the treatment of AMR in solid organ transplantation.
26680374 Heme arginate induces HO-1 in kidney transplant recipients.
26672618 Selective overexpression of HO-1 in proximal tubules protects against cisplatin nephrotoxicity.
26652036 The same mechanism of heme hydroxylation to alpha-meso-hydroxyheme is employed by both isoforms HO-1 and HO-2.
26600472 mercury increases oxidative stress (increased HO1 and NQO1 mRNA levels) and alters the cytoskeleton in the human endometrial Ishikawa cell line and to a lesser extent, in the "less-differentiated" human endometrial Hec-1b cells
26595750 HO-1 emerges as a novel immune regulator in neuroblastoma
26576971 was suggested that ultrasound stimulation of endothelial cells up-regulated HO-1 expression through intracellular oxidative stress, which subsequently changed the gene expression pattern so that it could modify vascular functions
26566708 Associations of HO-1 (GT)n polymorphism with cancer risk differs by histological subtype and the polymorphism should be considered a modifier in the risk assessment of arsenic exposure.
26555743 Admission plasma HO-1 levels had an AUC of 0.623 to predict 90-day mortality and an AUC of 0.611 to predict CPC 3 to 5. In conclusion, we found that higher HO-1 plasma levels are associated with longer ROSC and poor long-term outcome.
26534961 An apparent meso-hydroxyheme (forming with k = 0.6 min(-1), pH 7.4, 10 mm ascorbate, 10 mum IsdG-heme, 22 degrees C) was identified as a likely common intermediate with the canonical heme oxygenases.
26512585 The T(-413)A SNP in the HO-1 promoter is significantly associated with albuminuria development in type 2 diabetes patients.
26507778 Data suggest gene expression in vascular endothelium is altered by dietary factors; aged garlic extract induces expression of HMOX1 and GCLM (glutamate-cysteine ligase modifier subunit) via activation of NRF2-(nuclear factor erythroid 2-)ARE signaling.
26483091 Review of the available literature on the epidemiological association between the HO-1 (GT)n repeat polymorphism and cardiovascular diseases supports the presumed protective effects of HO-1.
26456668 HO-1 overexpression sharply decreases the apoptosis of bone marrow-derived mesenchymal stromal cells in the injured kidney.
26445536 heme oxygenase-1 expression is induced by gold nanoparticles through Nrf2 activation and Bach1 export in human vascular endothelial cells
26418896 Data suggest that HO-1-derived CO from tumor-associated macrophages influences, in part, E-cadherin expression and thus tumor initiation and progression.
26416069 HMOX-1 (GT)n repeat length polymorphism is a potential susceptibility variant for cancer in Asians (Meta-Analysis)
26405158 HO-1 is an essential enzyme for iron-dependent lipid peroxidation during ferroptotic cell death
26385579 Nrf2-driven CD36 and HO-1 expression on innate immune cells could contribute to a protective and detoxifying mechanism during pregnancy-associated malaria.
26385185 Induction of HO-1 by carbon monoxide releasing molecule-2 attenuates thrombin-induced COX-2 expression and hypertrophy in primary human cardiomyocytes.
26350099 Finally, the effect of NGAL down-regulation on the growth of human lung adenocarcinoma was determined in BALB/c nude mice.
26337933 Severity of TR varied inversely with hmox-1 expression, suggesting that hmox-1 expression affects pulmonary vascular reactivity after PE.
26315932 These findings indicate that impairment of neutrophil oxidative burst activity in sickle cell disease is associated with hemolysis and heme oxygenase-1 expression.
26313808 The present study suggests a weak association between HMOX1 rs2071746 polymorphism and the risk to develop RLS in the Spanish population
26303499 HO-1 expression can strongly influence apoptosis via CO-mediated regulation of Kv2.1 activity
26291278 Our data highlights the complex interplay between Nrf2 and H3S10 phosphorylation in arsenite-activated HO-1 transcription.
26283888 transcription activation of HO-1 resulting from the nuclear translocation of NFE2L2 is the underlying molecular mechanism for its high induction, which, in turn, is responsible for the resistance of human osteosarcoma cells to arsenic trioxide treatment
26277392 Most importantly, however, as detected by immunofluorescence and Western blotting, 2-nitro-IS induces the expression of heme oxygenase-1 and thereby the formation of ROS; most probably through the Fenton reaction.
26270345 HO-1 activity triggers the induction of ferritin and the latter is actually responsible for the cytoprotective effects of HO-1 activity.
26269184 Induction of HO-1 deficiency and associated glutamate-mediated neurotoxicity is a highly conserved HIV phenotype of chronic macrophage infection that is resistant to antiretroviral therapy.
26244607 sensitizer-induced up-regulation of both the endogenous HMOX1 and the luciferase constructs under the control of the HMOX1-ARE or the full HMOX1 promoter appear to be under the control of both Nrf2 and Bach1.
26238954 Increased frequency of a long GT repeat in the HMOX1 promoter was associated with late radiation effects in both African American and white populations.
26227317 established a new function for BRCA1 in the survival and fate of prostate tumor cells, orchestrating oxidative stress and mounting a transcriptional regulatory machinery commanding HO-1 transcriptional activation
26218201 Overexpressions of HO-1, HIF-1a, and GLUT1 might be involved in the chemoresistance of AML. HO-1 is a potential target to overcome the drug resistance of AML.
26186946 induction of the HO-1/CO system by CO not only improves muscle mitochondrial density, but regulates myoglobin content, GLUT4 localization, and capillarity in accordance with current concepts of skeletal muscle plasticity
26173399 Linkage disequilibrium was observed between the HO-1 polymorphisms.
26143632 These results demonstrate that induction of HO-1 does not directly enhance adiponectin production or ameliorate the pro-inflammatory effects of TNFalpha and argue against a direct HO-1 - adiponectin axis.
26142705 Studies indicate the role of heme oxygenase 1 (HMOX-1) in creating tolerogenic niches in sickness (tumorigenesis) and health (normally progressing pregnancies).
26125799 Combined administration inhibited the cells most potently and time-dependently, decreased the expression of HO-1, and significantly increased the expression of ATF4, CHOP, and Ire-1 proteins expression levels
26091465 a weak association between HMOX1 rs2071746 polymorphisms and the risk to develop essential tremor in the Spanish population
26087182 HO-1 expression is functionally linked to the mediation of tumor progression and metastasis of colorectal cancer cells by inhibiting antitumor immunity.
26041409 activation of Src/STAT3/HO-1/autophagy signaling pathway might play a general role in protecting certain subtypes of breast cancer cells from doxorubicin-induced cytotoxicity
26011642 Upon loss of attachment in tumor cells, ATF4 activated a program of cytoprotective autophagy and antioxidant responses, including induced expression of heme oxygenase 1 (HO-1). Increased levels of HO-1 ameliorated oxidative stress and cell death.
26011640 patients with subarachnoid hemorrhage have markedly higher HO-1 activity in CSF compared with that in patients with unruptured cerebral aneurysms.
25962859 Data suggest activities of HO1 and NFE2L2 (nuclear factor erythroid 2 like 2) are regulated by dietary components; here, antioxidant dietary supplement, extract of Nelumbo nucifera leaves, up-regulates HO1 and NFE2L2 activities in hepatocytes.
25961023 HMOX1 mRNA is selectively retained in HIV-1 Nef-expressing cellular exosomes, and five miRNAs (miR-15b, miR-26b*, miR-125b, let-7a, and let-7e*) which target HMOX1 mRNA are selectively secreted in exosomes from these cells
25956277 Significant association was found between short allele (SS + SL genotypes) and risk of gastric cancer, and also strong association was found between SS genotype and risk of gastric cancer metastasis.
25933176 polymorphisms of HMOX1 and NQO1 genes are associated with a high risk of metabolic disorders.
25921464 carbon monoxide-releasing molecule-2-induced heme oxygenase-1 protein and mRNA levels were inhibited by the inhibitor of c-Src
25891083 Curcumin inhibits appoptosin-induced apoptosis in SH-SY5Y cells by upregulating the expression of HO-1.
25888733 This current study did not find any evidence of association between HMOX1 promoter polymorphisms and malaria susceptibility or severe malaria and hence contradicts previous findings.
25883219 PKCepsilon-CREB-Nrf2 signalling induces HO-1 in the vascular endothelium and enhances resistance to inflammation and apoptosis.
25864768 HO-1 protein is expressed in the cytosols of skin cancer cells.
25835554 Obese children with longer GT repeats in the HO-1 gene promoter and insulin resistance were susceptible to nonalcoholic fatty liver disease.
25828744 A molecular role for HO-1 in inhibiting cell apoptosis, allowing it to be a potential target for treating acute myeloid leukemia.
25822459 The number of HO-1 promoter GT(n) polymorphism is increased in both IDCM and CRF children with HF, but is unrelated to plasma markers of different pathological processes.
25820186 Study correlated glial HO-1 overexpression with altered miRNA patterns, which have been linked to the aforementioned "core" neuropathological features
25802333 the results support the anti-apoptotic role of HO-1 induced by NHE1 in the K562R cell line and IM-insensitive CML patients
25776458 The antioxidant enzyme HO-1 is up-regulated by myrosinase treated glucoerucin in HT-29 cells.
25772769 In ovarian endometriomas the autophagic process is up-regulated, and suggesting signaling involving TP53/HO-1 pathway.
25751573 The study did not find an association between the GT(n) tandem repeat of HO-1 and acute kidney injury (AKI) nor bronchopulmonary dysplasia/mortality. However, infants with TT genotype of the 413T>A SNP had lower incidence of AKI.
25677507 Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway.
25661467 this study is the first to demonstrate that HG treatment of A549 human lung epithelial cells promotes tumor cell invasion and increases metastasis-associated protein expression by up-regulating HO-1 expression via ROS or the TGF-b1/PI3K/Akt signaling
25656973 the findings in myometrium indicate HO-1 expression is increased with labour and exerts pro-inflammatory effects via NF-kappaB during cytokine- and Toll-like receptor ligand-induced inflammation.
25652861 Mycoplasma genitalium LAMP negatively regulate TNF-alpha and IL-1beta secretion by inducing HO-1 expression in placental trophoblast cells.
25645920 Human c-Met can promote increased survival of renal cancer cells through the regulation of HO-1 and PD-L1.
25638774 Induction of heme oxygenase-1 contributes to survival of Mycobacterium abscessus in human macrophage-like cells.
25620054 HO-1 expression protected HMECs from diesel exhaust particle-induced prooxidative and proinflammatory effects.
25615876 cytoprotective effect of pPolyHb involves upregulating HO-1 and subsequently decreasing the phosphorylation of the JNK and p38 MAPK and ROS generation.
25612606 Study showed that the immunoregulatory effect of HO-1 in individuals with acute coronary syndrome is mediated by the up regulation of LAP and GARP expression on activated T cells.
25608140 Transforming growth factor-beta1 preserves loss of epithelial barrier integrity caused by the stress of hypoxia-reoxygenation via a mechanism that may involve the upregulation of HO-1 transcription
25585641 The HO-1 expression in Myelodysplastic syndrome patients with high-risk was higher than in low-risk patients.
25582460 Exogenous haptoglobin attenuated the HbA-induced HO-1 expression in renal proximal tubule cells.
25574604 No interactions were found between diet or lifestyle and HMOX1 A-413T.
25530680 Myeloperoxidase oxidized LDL interferes with endothelial cell motility through miR-22 and heme oxygenase 1 induction
25501830 HO-1 protects against Alzheimer's amyloid-beta induced toxicity via carbon monoxide production.
25486479 Data are consistent with a mechanism in which Fhit protein is required for accumulation of the transcriptional repressor of HMOX1, Bach1 protein.
25475440 The role of bilirubin in diabetes-associated vascular damage was studied.
25450361 involvement of specific virus-induced snRNAs and associated gene clusters suggests a novel HO-1-dependent host-defense pathway in poxvirus infection
25447985 Results point towards a vital cytoprotective role of HO-1/CO signaling after microglial activation, support a therapeutic potential of CO releasing chemical agents in the treatment of excessive inflammatory conditions in the CNS
25431258 Activating the NRF-2/HO-1 signaling pathway.
25428780 This review examines the protective role of HO-1 and its downstream effectors in modulating inflammatory diseases of the upper (esophagus and stomach) and lower (small and large intestine) gastrointestinal tract, the liver, and the pancreas.
25404134 The study demonstrated that the regions adjacent to human HO-1 enhancers are actively transcribed into non-coding RNA which are required for HO-1 induction.
25377948 regulated by TRIF signaling after DNCB skin sensitization
25359861 Strong association between HO-1 variable number tandem repeat polymorphism and cardiovascular disease risk confined to subjects with a high number of repeats on both HO-1 alleles, resulting in accelerated atherogenesis and decreased antioxidant defense.
25280089 The level of intrathecal CSF HO-1 at Day 7 post-subarachnoid hemorrhage can be an effective outcome indicator in patients with Fisher Grade III aneurysmal subarachnoid hemorrhage.
25277974 In the steady state, HO-1 promoter genotypes, based on the length of (GT)n repeats, do not modulate heme catabolism or 3rd day bilirubin values in either G6PD-normal or -deficient neonates.
25268359 The HO-1 microsatellite polymorphism may contribute to the genetic background of atrial fibrillation in Chinese-Taiwanese patients.
25262966 Overexpression of HO-1 in a subset of thyroid cancers is associated with tumour aggressiveness
25262300 variations of HMOX1 might affect the downstream products biliverdin and bilirubin.But in this study, no contribution from HMOX1 was found
25241054 The present current evidence indicates that HO-1 induction mediated by multiple pathways can drive the phenotypic shift to M2 macrophages
25239913 results demonstrate that multiple regulatory factors, such as impaired TLR4 surface expression, increased intracellular iron, and decreased HIF-1alpha, downregulate HO-1 expression
25236576 our results demonstrate an antitumoral role of HO-1 in colorectal cancer and points to the importance of p53 status in this antitumor activity
25231232 For the first time, we verified that endoplasmic reticulum and mitochondrial apoptotic pathways were activated by small interfering RNA that targeted-silenced the expression of HO-1 in AML-M2 Kasumi-1 cells
25218961 Findings indicate a differential impact of HO-1 on patterns of brain sterol and redox homeostasis that is contingent on the presence or absence of Alzheimer's disease-like neuropathology
25207998 illustrated and reviewed the biological function of HO-1 and the use of UVA1 wavebands (340-400 nm) for phototherapy; the potential use of HO-1 induction in UVA therapy of morphea is also discussed
25202977 HO-1 is a protective host factor against HIV-mediated neurodegeneration; HO-1 deficiency contributes to this degeneration
25201427 HO-1 gene promoter polymorphism may be associated with diastolic blood pressure, mean arterial pressure, body mass index and anthropometric measures.
25199502 evaluate the combined effect of the four transcription factors on HMOX1 expression and the resulting alleviation of stress
25196646 These results suggest an important role of HO-1 in the modulation of adaptive immune responses.
25187885 The HMOX1 genotypes were not found to be associated with CAD, but the short allele carrier group contained more individuals with hsCRP values reflecting low risk of cardiovascular disease in the Korean population.
25162226 Induction of Prx1 by hypoxia regulates heme oxygenase-1 via NF-kappaB in oral cancer.
25150395 Slow freezing more effectively up-regulates HO-1 expression and down-regulates ROS than vitrification during cryopreservation of seminiferous tubules.
25122478 results suggest that the c-Src, NADPH oxidase, PI3K, and Akt signaling pathways play important roles in EGF-induced NF-kappaB activation and HO-1 expression in HT-29 cells
25110805 serum levels increased in patients with pre-eclampsia compared with normotensive pregnant women
25109682 new insight into how MSU-induced gouty inflammation is mediated by specific mechanisms that are involved in the Nrf2/Ho-1 antioxidant signaling pathway
25069505 The induction of HO-1 by hemin attenuates lipopolysaccharide-induced inflammatory damage in human gingival epithelial cells.
25064159 HMOX1 mRNA is selectively retained in HIV-1 Nef-expressing cellular exosomes, and five miRNAs (miR-15b, miR-26b*, miR-125b, let-7a, and let-7e*) which target HMOX1 mRNA are selectively secreted in exosomes from these cells
25063314 The clinical correlations of HO-1 were regulated by a complex mechanism that depended on smoking intensity.
25036905 Patients with necrotizing disease more often had the LL (>27 GT repeats)genotype vs those with edematous acute pancreatitis. The L/L allele doubles the risk of pancreatic necrosis in patients with acute pancreatitis.
25023856 Site-directed mutagenesis on HO-1 probes the reduction of Fe(IV)=O(Por(.+)) by tyrosine residues within 11 A of the prosthetic group. In HO-1, Y58. is implicated as the most likely site of oxidation, based on the pH and pD dependent kinetics.
25016572 This study demonistrated that Association of heme oxygenase-1 gene rs2071746 polymorphism with vascular outcomes in patients with atherosclerotic stroke.
24995976 Study shows that HO-1 drives insulin resistance in mouse and man; in matched biopsies from "healthy" versus insulin-resistant obese subjects we find HO-1 to be among the strongest positive predictors of metabolic disease in humans.
24969894 There was no association between HO-1 (GT)n repeat polymorphism and the cancer risk.
24957789 HO-1, S100A4, and SYND1 expressions have prognostic value in primary non-muscle-invasive bladder cancer (NMIBC).
24931165 Results show that nuclear HO-1 promoted cancer cell growth and aggressiveness independently of its enzymatic activity.
24819505 action of thymidine phosphorylase in non-small cell lung cancer: crosstalk with Nrf2 and HO-1
24813593 HO-1 is an effective mechanism for reducing acute myocardial stress such as excess beta-adrenergic activity. However, in our age and pressure overload models, HO-1 showed detrimental rather than therapeutic effects in the development of heart failure.
24801208 Knockdown of KLF2 or HO-1 abrogated effects of statins on HCV replication.
24799610 In conclusion, the GTn long allele seems to predispose to late-onset, less severe form of preeclampsia.
24786516 miR-320a has a role in modulating the induction of HO-1, GCLM and OKL38 by oxidized phospholipids in endothelial cells
24762402 A greater number of guanosine thymidine dinucleotide repeats in the heme oxygenase-1 gene promoter is associated with higher risk for kidney disease, cardiovascular events, and mortality among patients with coronary artery disease.
24752012 Higher HMOX1 expression correlated with higher expression of Bach-1 (Spearman's rho = 0.586, p = 0.000001) and miR-122 (Spearman's rho = 0.270, p = 0.014059).
24733848 studies indicated recruitment of Brd2 and Brd4 to Nrf2-binding sites on the promoters of heme oxygenase-1 and NADPH quinone oxidoreductase 1.
24694788 Transfer of HO-1 gene by adenoviral vector exerts a protective effect including anti-inflammation and organ protection by enhancing the vector expression of HO-1 in severe acute pancreatitis.
24690955 The HO-1 (A-413T) polymorphism had no effect on serum bilirubin levels or graft outcomes.
24670375 We performed a systematic review and meta-analysis of heme oxygenase 1 gene (HO-1) promoter polymorphisms and susceptibility to coronary artery disease (CAD) based on eligible studies retrieved from electronic databases from 2002 to 2013.
24655000 Data suggest HMOX1 contributes to inhibition of inflammation in cancer cells; some HMOX1 epitopes are found exclusively on tumor tissue; targeted inhibition of HMOX1 may cause tumor cells to become more sensitive to chemotherapy. [REVIEW]
24636201 Data revealed that HO-1 is overegulated in cancer tissues of renal cell carcinomas patients through the downregulation of MAT2A, its repressor.
24616552 induction of HO-1 by CO-RM2 exerted anti-inflammatory and antioxidant effects which are required in concert to prevent the activation of NF-kappaB leading to induction of various inflammatory genes implicated in the pathogenesis of RA
24613679 The Bach1-dependent repression of the HO-1 expression is under the control of the Hx-dependent uptake of extracellular heme
24612419 Findings suggest a positive association among intraleaflet hemorrhage, neovascularization, and enhanced expression of CD163 and HO-1 as a response to intraleaflet hemorrhage in stenotic aortic valves in AS patients undergoing HD.
24607880 Results suggest that the increase in iNOS and HO-1 mRNAs expression in cumulus cells is a negative index of oocyte fertilizability.
24585089 Lower circulating HO-1 is associated with a higher risk of PCOS in non-obese women, in a dose-related manner.
24568186 upregulation of p53 and p21 via HO-1 induction and subsequent release of iron with accumulation of H-ferritin may confer resistance to oxidative damage in cancer cells frequently challenged by redox-cycling anticancer drugs.
24553299 Suggest that beta-ENaC mediates cytotrophoblast migration and increasing beta-ENaC expression by HO-1 induction enhances migration.
24512908 Our results thus indicate that the glutathionylation of p65 is likely to be responsible for CO-mediated NF-kappaB inactivation and that the HO-1-dependent pathway may prolong the inhibitory effects of CO donors upon TNFalpha treatment of ECs.
24500083 demonstrate a functional link between HO-1 gene expression and PECAM-1 in endothelial cells, which might play a critical role in the regulation of inflammation
24497084 These results show that shTNFRI-Fc and HA-hHO-1 TG pigs generated by the F2A self-cleaving peptide express both shTNFRI-Fc and HA-hHO-1 molecules, which provides protection against oxidative and inflammatory injury
24485305 study showed that the objective stress perception together with (GT)n promoter repeat polymorphism in the HO1 gene influence eating disorder pathology or stress-related disorders
24456890 Nrf-2 translocation could play a part in induction of Nrf-2-HO-1-HMGB1 axis regulation in myocardial reperfusion injury.
24440642 HO-1 promotes mitochondrial damage and corpora amylacea biogenesis in astrocyte cultures and in the intact aging brain.
24413553 Brain tumor patients had carboxyhemoglobin concentrations of 1.5% +/- 0.5% (mean +/- SD), indicative of HO-1 upregulation
24366007 these results suggest that nutlin-3 induces HO-1 expression via the activation of both JNK which is dependent on ROS generated by p53 translocated to the mitochondria and p38 MAPK which appears to be stimulated by a ROS-independent mechanism
24320035 HO-1 plays an important role in contributing to metabolic control.
24300974 GA could inhibit NF-kappaB and MAPK/HO-1 signalling pathways.
24239896 Induction of HO-1 via the reactive oxygen species (ROS)-Nrf2 pathway counteracts the anti-proliferative and inflammatory actions of contrast media-induced endothelial and organ dysfunction.
24234335 our results corroborate the higher frequency of HO-1 protein expression in gliomas than in normal brain
24226420 5-LO disruption improves wound healing and alters fibroblast function by an antioxidant mechanism based on HO-1 induction.
24211270 The induction of HMOX1 suppresses the proliferation of breast cancer cells through its byproduct carbon monoxide.
24201221 The inflammatory and antioxidant response and the relationship with the HMOX1 levels and HMOX1 polymorphism in Mexican septic pediatric patients.
24200599 The cellular stress response or cytoprotective signaling mediated via the Nrf2-HO-1 axis is hijacked by cancer cells for their growth advantage and survival of anticancer treatment. (Review)
24180625 Expression of nerve growth factor and heme oxygenase-1 predict poor survival of breast carcinoma patients.
24180608 The role and regulation of HO-1 in the diseased state. [Review]
24180287 The ability of HMOX1 to be induced by a variety of stressors, in an equally wide variety of tissues and cell types, represents an obstacle for the therapeutic exploitation of the enzyme. [Review]
24180257 Significance of the cross-talk between heme oxygenase-1 and its products with other metabolic pathways. [Review]
24147608 The immunomodulatory function of HO-1 in the mononuclear phagocyte system. [Review]
24140555 HO may be involved in the regulation of heart tissue inflammation and could be a potential target in conceiving future therapeutic approaches for Chagas disease.
24131232 The role of HO-1 in the vascular endothelium. [Review]
24117426 Andrographolide has the potential to control HCV replication and suggest that targeting the Nrf2-HO-1 signalling pathway might be a promising strategy for drug development.
24109237 Overexpression of HO-1 significantly attenuated Ebola virus growth.
24098580 Alternative 5' untranslated regions are involved in expression regulation of human HMOX1.
24075775 DHA-induced, ROS-dependent upregulation of HO-1 attenuates oxidative stress, UPR and apoptosis in DHA-treated human pulmonary artery vascular smooth muscle cells
24053682 The role of HO-1 in cell differentiation and HO-1-dependent signal transduction pathways. [Review]
24053646 Data indicate that Compound 1 activated the expression of Nrf2-regulated ARE, HO-1, and NQO-1 and facilitate nuclear translocation of Nrf2.
24038461 elevated HO-1 expression in chondrocytes is protective of cartilage in inflamed joints but may otherwise suppress matrix turn over.
23981612 Overexpression of HO-1 promotes Caco-2 cell proliferation and migration by targeting the CTNND1 gene.
23939757 we discuss the role of a potential regulatory feedback loop between HMOX1 and miRNAs in pathological processes based on recently published data
23925400 The Bcl-2 and HO-1 proteins seem to have important roles in the antiangiogenic environment of preeclampsia.
23919806 The expression of YY1 significantly correlates with that of HO-1 in esophageal squamous cell carcinoma tissues.
23893806 demonstrated that Heme Oxygenase-1 contributed to the up-regulation of CD4+CD25+CD127low/- regulatory T cells mediated by mesenchymal stem cells in asthma
23877636 (GT)n repeat of HO-1 gene is highly polymorphic in distribution, ranging in length from 15 to 40. Shorter (GT)n repeat (<20) is an independent risk factor for neonatal hyperbilirubinemia risk in neonates.
23840483 Downregulation of Nox4 activity by HO-1 induction appears to be mediated by carbon monoxide.
23813560 Chronic hemodialysis patients with longer lengths of guanosine thymidine dinucleotide repeats in the heme oxygenase-1 gene promoter exhibit higher inflammation
23792437 We believe that a dysfunctional HO-ferritin system leads to increased levels of proinflammatory mediators, thus contributing to the inflammation characteristic of pterygia.
23739547 Nrf2/HO-1 signaling is required for the regulation by tBHQ of ABCA1 expression and cholesterol efflux in macrophage-derived foam cells and an antiatherogenic role of tBHQ is suggested.
23737527 Data indicate that transcription factors MafK and Bach1 regulate expression of heme oxygenase-1 (HO-1).
23728734 In a representative European Caucasian cohort of alcoholic liver disease patients, microsatellite (GT)n repeat variant polymorphism in the promoter of the HO-1 gene was not associated with the presence of the disease or its severity.
23725037 Polymorphism in the HMOX1 gene is associated with high levels of fetal hemoglobin in Brazilian patients with sickle cell anemia.
23720344 cytosolic HO-1- and Mito-HO-1-expressing cells were protected against hypoxia-dependent cell death and loss of mitochondrial membrane potential
23716558 SNPs in the HMOX1 promoter were associated with development of inhibitory antibodies to therapeutic factor VIII in severe hemophilia A.
23714423 HO-1 expression is reduced in peripheral blood mononuclear cells of multiple sclerosis patients.
23671274 Data suggest a pathway in which thioredoxin (Trx) acts as a tonic, endogenous regulator of Cav3.2 channels, while heme oxygenase-1 (HO-1)-derived carbon dioxide (CO) disrupts this regulation, causing channel inhibition.
23665328 A novel role is identified for HO-1 in the modulation of host immune response against HIV human immunodeficiency virus-type-1 infection of human monocyte-derived macrophages.
23660665 We suggest that atheroma plaques show a more pronounced induction of CD163 and HO-1.
23617628 Interplay between HMOX1 and miR-378 significantly modulates non-small cell lung carcinoma progression and angiogenesis.
23615401 Transfection with HO-1 small interfering RNA knocked down the HO-1 expression and reversed the inhibition of MMP-9 expression by AP.
23606537 results demonstrate the counterregulatory heme oxygenase-1/CO pathway, which is critical in balancing and limiting the inflammatory response, is defective in cystic fibrosis macrophages through a CAV-1-dependent mechanism, exacerbating the cystic fibrosis macrophage response to lipopolysaccharide
23602216 showed that shorter (GT)n repeat in the HO-1 gene promoter were associated with a lower Jeopardy severity score in patients with significant coronary artery disease
23583371 findings indicated that HO-1 might have an angiogenic effect in CNV through modulation of VEGF expression and might be a potential target for treating CNV
23580430 HCMV infection influences Nrf2 expression and activates HO-1 expression through Nrf2.
23571756 The results implicate Nrf2-dependent Z-DNA formation in HO-1 transcriptional activation.
23569422 the potential roles of ERK, p 38 MAPK and JNK in the regulation of propofol-induced endogenous HO-1 expression in SH-SY5Y cells were estimated by Western blotting assays
23567851 Anti-oxidant response element (ARE)-binding activity of Nrf2 for heme ocygenase-1 (HO-1) was demonstrated.
23536693 These results demonstrate that Mycoplasma fermentans MALP-2 induces HO-1 expression via MAPKs and Nrf2 pathways and, furthermore, that MALP-2-induced COX-2 expression was modulated by HO-1 in THP-1 cells.
23526997 HIF-1alpha and HO-1 levels in elderly patients undergoing non-cardiac surgery were significantly higher in the group with postoperative adverse cardiac events at each time point.
23521418 HO-1 deficiency causes an inflammatory immune reaction and diminished expression of protective molecules in trophoblasts
23454680 Inhibition of Nrf2/HO-1 leads to more alpha-syn aggregation and greater toxicity induced by iron, creating a vicious cycle of iron accumulation, alpha-syn aggregation and HO-1 disruption in PD.
23437133 In conclusions, HO-1 gene promoter polymorphisms were associated with atrial fibrillation recurrence after catheter ablation.
23430116 the frequency of GT microsatellite repeat polymorphism in HO-1 in Croatian individuals with confirmed and excluded abdominal aortic aneurysm, was determined.
23423194 findings suggest that the cytoprotective effects of HO-1 are mediated by suppression of TNF/TNFR1-mediated apoptotic signaling, specifically by modulating apoptotic DISC formation and mitochondrial TNFR1 translocation during hepatic ischemia/reperfusion.
23412940 Upregulation of HO-1 is accompanied by activation of p38MAPK and mTOR in human oesophageal squamous carcinoma cells
23406650 Promoter polymorphism of HMOX1 do not affect genetic susceptibility in systemic sclerosis.
23406266 HO-1 induction in either healthy or osteoarthritic chondrocytes is able to offset the catabolic and anti-anabolic actions of inflammatory cytokines, and it exerts stronger anti-inflammatory and chondroprotective effects in hypoxic conditions.
23403272 Paeoniflorin protected EA.hy926 cells against radiation-induced injury through the Nrf2/HO-1 pathway.
23403148 collective actions of the heme breakdown metabolites generated by HO-1 offer protection against cytotoxicity, inflammation, hypoxia and other forms of cellular stress that are central to the pathogenesis of severe pre-eclampsia[review].
23392716 In conclusion, induction of HO-1 over-expression alone is not enough to protect PECs from human xenoantibodies and complement-mediated humoral injury.
23347118 Suggest anandamide and FAAH as direct modifiers in signalling mediated activation of Nrf2-HO-1 pathway.
23345623 Length polymorphisms of heme oxygenase-1 determine the effect of far-infrared therapy on the function of arteriovenous fistula in hemodialysis patients.
23324179 expression induced by activation of AMP-activated protein kinase, which inhibits epithelial-mesenchymal transition in renal fibrosis
23293173 Carotid ultrasound and HO-1 polymorphism improve coronary atherosclerosis prediction.
23288142 Docosahexaenoic acid inhibits matrix metalloproteinase-9 expression, mediated by heme oxygenase 1,in 12-O-tetradecanoylphorbol -13-acetate-induced MCF-7 human breast cancer cells.
23255485 Genistein up-regulated HO-1 and Glutamate-Cysteine Ligase expression through the EKR1/2 and PKC /Nrf2 pathways during oxidative stress.
23238643 early stage of exposure to IH-induced oxidative and inflammatory stresses leading to acceleration of cell apoptosis via NF-kappaB and Nrf2/HO-1 pathways
23226098 interaction between STAT3 and HO-1 abrogates STAT3 activation, and in this way, HO-1 induction represses AR activity, affecting PCa cells tumorigenicity.
23221079 HO-1 protein was upregulated by treatment with both hydrogen peroxide and light for retinal pigment epithelial cells.
23158494 HO-1 plays an anti-apoptotic role in human bone marrow mesenchymal stem cells.
23150184 HO-1 has a critical role in the modulation of peritoneal fibrosis, and, more important, the suppression of epithelial-to-mesenchymal transition
23139759 Serum HO-1 concentrations were inversely associated with subsequent gestational diabetes mellitus risk.
23123430 Vascular endothelial inflammation was inhibited by inducing heme oxygenase-1.
23114386 Serum heme oxygenase-1 was associated with more rapid decline in lung function in patients with chronic silicosis.
23103292 HO-1 gene expression is upregulated by anti-dengue virus nonstructural protein-1 antibodies via activation of a redox-dependent PDI/PI3K/Akt-mediated pathway in human ECs.
23097500 Using X-ray crystallography, the structures of several complexes of HO-1 with novel inhibitors have been elucidated, which provided insightful information regarding the salient features required for inhibitor binding.
23092328 both HO-1 and BCRP protect against heme-induced toxicity and may thus form novel therapeutic targets for heme-mediated pathologies
23090292 HSP72 and HSP32 were significantly increased in monocytes and lymphocytes from 45 min post-exercise.
23087099 Results suggest the therapeutic potential of HO-1 for prevention of adverse effects in critical limb ischaemia.
23074199 These results indicate that osteopontin activates Nrf2 signaling, resulting in enhanced HO-1 expression and cell migration in glioma cells.
23055342 HO-1 is a poor prognostic predictor and its over-expression may increase the metastatic potential of non-small cell lung cancer
23052192 Hard-metal (WC-Co) particles trigger a signaling cascade involving p38 MAPK, HIF-1alpha, HMOX1, and p53 activation in human peripheral blood mononucleated cells.
23051580 Authors show that nitric oxide and haemin, two inducers of HO-1, decrease the level of phosphorylated CagA in Helicobacter pylori-infected gastric epithelial cells.
23046979 DATTS activates the ROS-eIF2alpha/Nrf2 HO-1 signaling cascades leading to the up-regulation of HO-1.
23010497 On proteasome inhibition HDAC6 deacetylates p38, allowing the subsequent phosphorylation of p38 and resultant activation of NRF-2 to induce expression of HO-1.
22989377 HMOX1 overexpression leads to enhanced destruction of heme, induction of ferritin and compensatory increase of heme synthesis.
22966170 We provide evidence that genetic variation in HMOX1 is associated with decreased rates of hospitalization for acute chest syndrome, but not pain, in patients with Sickle cell disease
22959128 Results support a key role for the heme oxygenase system in protecting patients at increased risk for thrombosis.
22945906 Peroxisome proliferator-activated receptor delta agonist attenuates nicotine suppression effect on human mesenchymal stem cell-derived osteogenesis and involves increased expression of heme oxygenase-1.
22939811 These findings support the hypothesis that NAFLD is an important process for hepatocyte oxidative stress and injury in liver diseases. They also suggest that HCV can repress HO-1 induction in vivo even when other inducers of HO-1 are present.
22901690 HO-1 plays a down-regulatory role in NF-kappaB nuclear translocation
22881289 Sustained upregulation of HMOX1 in astrocytes promotes pathological brain iron deposition and oxidative mitochondrial damage.
22879597 The heme oxygenase 1 inducer (CoPP) protects human cardiac stem cells against apoptosis through activation of the extracellular signal-regulated kinase (ERK)/NRF2 signaling pathway and cytokine release
22875919 This study demonistrated that Schizophrenia-like features in transgenic mice overexpressing human HO-1 in the astrocytic compartment.
22849380 data showed that cirrhotic patients carrying both HO-1 AS and vascular endothelial growth factor GT risk haplotypes have high probability of esophageal varices bleeding compared with those not carrying the above risk haplotypes.
22843690 analysis of filament formation of the FtsZ/tubulin-like protein TubZ from the Bacillus cereus pXO1 plasmid [TubZ]
22842631 These data demonstrated that globular adiponectin prevents ethanol-induced apoptosis in HepG2 cells via HO-1 induction and revealed a novel biological response of globular adiponectin in the protection of liver injury from alcohol consumption.
22776971 The current study reports increased levels of both HO-1 and BVR-A in plasma from probable Alzheimer disease patients, as a result of the increased oxidative environment.
22750196 Understanding how HO-1 mediates cardiorespiratory responses could provide important insights into clinical syndromes such as obstructive sleep apnea--{REVIEW}
22698995 let-7 miRNA directly acts on the 3'-UTR of Bach1 and negatively regulates expression of this protein, and thereby up-regulates HMOX1 gene expression.
22689053 the tumorigenic role of HO-1 and the importance of TRC8-mediated HO-1 degradation in the control of cancer growth
22682876 Data show that erum concentrations of HO-1, sCD163 and IL-10 in systemic juvenile idiopathic arthritis (s-JIA) patients were markedly elevated in the active phase.
22670665 In this study, examined the expression of HO-1 in B16F10 melanoma and 4T1 breast cancer cells after cell exposure to proteasome inhibitors.
22666428 no association between HMOX1 variants and the pathogenesis of pancreatitis
22630328 Data suggest that urinary heme oxygenase-1 (uHO-1) level could be a potential biomarker for evaluating the progression of obstructive nephropathy.
22613607 While affected by HIF-1, HO-1 up-regulation promotes the expression of HIF-1 and the down-regulation of HO-1 suppresses the expression of HIF-1 gene.
22609818 rs2071746 in HO-1 gene, rs1330344 in COX-1 gene contribute to resistance to aspirin.
22594519 Review of the role that HO-1 plays in placental vasculature development and how HO-1 deficiency may contribute to pregnancy complications, such as fetal growth restriction, pre-eclampsia, spontaneous abortions and premature births.
22587389 study found a significant decrease in HO-1 expression, specifically in monocytes from patients with systemic lupus erythematosus suggesting that an imbalance of monocyte function could be partly the result of a decrease in HO-1 expression
22583702 Heme oxygenase microsatellite polymorphism is not associated with oxidative stress, glycemic control, and complication development in type 2 diabetes.
22580187 HO-1 is up-regulated in head and neck squamous cell carcinomas and that nuclear localization of HO-1 is associated with malignant progression in this tumor type.
22579918 There is a novel and coordinated adaptive response of nonerythroid cells to sustained HO-1 induction that has an impact on cellular iron homeostasis.
22578957 analysis of the microsatellite polymorphism in haem oxygenase 1 gene promoter in multiple sclerosis
22578468 Stress-responsive HO-1 induction develops without autophagic alteration in motor cortex of TDP-43 A315T transgenic mice.
22573121 Using a human model opposite to hypertension, this study provides information on the relationships between CGRP, heme oxygenase-1, FMD, major clinical and biochemical factors involved in cardiovascular disease, and EPC-specific populations
22559824 HO-1 and HO-2 contribute little in the pathophysiology of adenomyosis.
22549002 increased protein levels in the hippocampus of Alzheimer disease subjects
22545110 Proteolytic regulation and nuclear translocation under hypoxic conditions is specific for HO-1. NADPH cytochrome P450 reductase prevents this translocation and promotes oligomerization of HO-1.
22542718 Data show hsp70-2 (+1267A/G) polymorphism was significantly associated with chronic obstructive pulmonary disease (COPD), but no association for hsp70-hom (+2437T/C), TNF-alpha (+489G/A) and HMOX-1 (number of GT repeats) polymorphisms were found.
22541814 Interaction between thrombin and protease-activated receptors increases heme oxygenase-1 expression in synovial fibroblasts.
22503972 These findings point to three novel functions of STC2, and suggest that STC2 interacts with HO1 to form a eukaryotic 'stressosome' involved in the degradation of heme.
22490514 HO-1 may have multiple effects on protection against carcinogenesis and progression in gastric cancer.
22461696 Heme oxygenase-1 promotes the persistence of Leishmania chagasi infection.
22438807 HMOX1 gene promoter alleles and high HO-1 levels are associated with severe malaria in Gambian children.
22427825 Elevated plasma HO-1 concentration is significantly associated with increased odds ratios for impaired glucose regulation.
22418244 HO-1 protein is upregulated in epithelial malignant cells in non-small cell lung cancer and its expression is associated with higher stages of the disease
22338608 Results suggest that HMOX1 (GT)n polymorphism was associated with susceptibility to childhood-onset systemic lupus erythematosus but not with juvenile rheumatoid arthritis in Mexican individuals.
22330859 The effects of 17beta-estradiol (E) (10, 40 nM) on 2 vasoprotective pathways, i.e. cyclooxygenase-2 (COX-2)-dependent prostanoids and the antioxidant heme oxygenase-1 (HO-1), in human umbilical vein endothelial cells, were studied.
22323644 Enhanced TALH HO-1 attenuated the hypertension induced by Ang II delivered by an osmotic minipump for 10 days (139 +/- 3 versus 153 +/-2 mmHg in the transgenic and control mice
22302482 Data indicate that heme oxygenase-1 (HO-1) may serve as a clinically useful biomarker of colon cancer and as a target for anticolon cancer drugs.
22290142 long (GT)n repeats in the microsatellite polymorphism region of the HMOX1 gene, the Hp2 allele, and the Hp2.2 genotype were associated with symptomatic malaria.
22276118 Two phenyl moieties are each stabilized by distinct hydrophobic pockets. This "double-clamp" binding offers additional inhibitor stabilization and provides a new route for improvement of human heme oxygenase inhibitors.
22271370 The findings of this study suggest that long (GT)n repeats in the HO-1 gene promoter are associated with a higher risk of malignant mesothelioma in the Japanese population.
22264017 Heme oxygenase-1 may be a useful biomarkers of exposure to amphiphilic polymer-coated CdSe/ZnS quantum dots.
22212955 No association between sporadic colorectal cancer risk and individual HMOX1 gene variants was observed.
22203790 Quercetin protects primary human osteoblasts from cigarette smoke induced damage. Inhibition of HO-1 reverses protective effects of quercetin.
22200625 HO-1 system may function as a crucial negative regulator in the modulation of inflammatory proces
22158875 Interleukin-19 (IL-19) induces heme oxygenase-1 (HO-1) expression and decreases reactive oxygen species in human vascular smooth muscle cells.
22155307 HO-1 decreases the production of relevant inflammatory and catabolic mediators that participate in osteoarthritis (OA) pathophysiology, thus eliciting protective effects in OA osteoblasts.
22147556 HO-1, a metabolically active enzyme in the papilla, but not in the pulp, inhibited the iNOS enzyme.
22142473 we have provided evidence that in neuroblastoma cells, the Nrf2/HO-1 axis plays a crucial role as a protective factor against cellular stress
22138245 Taken together with the biochemical function of HO-1 that catalyzes heme into CO and bilirubin, HO-1 expression may improve the circulation and compensate with oxidative tissue damages induced by hypoxia.
22137262 Data suggest that dietary factors (here, flavonoid epigallocatechin gallate) can induce HO-1 expression in vascular endothelium (here, primary aortic endothelial cells) via MAP kinase signaling and Nrf-2 [nuclear factor (erythroid-derived)-like 2].
22123460 protective HO1 promoter polymorphism correlates with a lower coronary artery plaque burden
22099756 FasL and HO-1 overexpression have beneficial effects in pancreatic islet transplantation
22095074 Cis-GS upregulated the transcription and protein expression of HO-1 to a greater extent than did trans-GS.
22088544 Nineteen different alleles, ranging from 17 to 39 repeats, with (GT)(23) and (GT)(30) being the most common ones, were identified in heme oxygenase-1 promoter region in a Greek cohort .
22078849 study suggests that both a reduction of HO-1 expression in epithelial cells and an increase of infiltration of macrophages positive for HO-1 are related to the epithelial damage of chronic rhinosinusitis with eosinophilic infiltration.
22048453 These data demonstrate that the HO-1 GT(n) microsatellite polymorphism is associated with higher levels of HO-1 expression and that this pathway may have important effects on the association between inflammation and HIV replication.
21992109 Studies indicate that the promoter polymorphism-dependent variability in HO-1 has been found to be associated mostly with the risk of cardiovascular disorders.
21987660 Inhibition of the nitric oxide-dependent induction of HO-1 in gastric epithelial cells is mediated by Helicobacter pylori virulence factor cagA.
21982894 The regulation of HMOX1 by the antioxidant-response element is firmly established, with the transcription factor BACH1 serving as a repressor and Nrf2 as an enhancer.
21945498 HO-1 short GT-repeat polymorphism may play a protective role in BP regulation and cardiovascular mortality risk in hypertensive arsenic-exposed individuals.
21911919 Concurrent inhibition of HO-1 expression in conjunction with chemotherapeutic treatment would improve the number of cases who reach complete remission.
21911884 Microsatellite variations in the HMOX1 and UGT1A1 genes are not likely to protect from progression of liver disease in patients with chronic hepatitis C.
21902835 found no association of the five HMOX1 tag SNPs with COPD lung function decline and no evidence that the three promoter polymorphisms affected the regulation of the HMOX1 gene
21898994 The expression level of HO enzyme is significantly decreased in the testis tissue of nonobstructive azoospermia patients.
21889036 HO-1 expression is also upregulated through the ROS, tyrosine kinase, and MAPK (JNK and p38) signaling pathways.
21868703 There is a heme oxygenase 1 via Nrf2-mediated pathway by which heme induces a homeostatic macrophage response following intraplaque hemorrhage.
21861350 No elevation of Nrf2 transcription was found, while inorganic arsenic could increase the Nrf2-regulated NQO1 and HO-1 mRNA expression in human hepatocytes.
21833623 Heme oxygenase-1 counteracts oxidative and inflammatory damage and is a modulator of the angiogenic switch in prostate carcinogenesis.
21827279 HMOX1 improves the survival of myoblasts, but concurrently through regulation of myomirs, may act similarly to oncogenes, increasing the risk of hyperplastic growth of myogenic precursors
21808062 The H-Ras-ERK-induced and HO-1-mediated pathway could protect renal cancer cells from apoptosis.
21781496 HO-1 expression increased resistance of K562 cells to hemin.
21765894 Erythroid precursors were characterized by lack of significant expression of HO-1 and by progressive reduction of HO-2 during differentiation.
21756955 HMOX1 mRNA is selectively retained in HIV-1 Nef-expressing cellular exosomes, and five miRNAs (miR-15b, miR-26b*, miR-125b, let-7a, and let-7e*) which target HMOX1 mRNA are selectively secreted in exosomes from these cells
21742584 Real-time PCR validated that up-regulation of sulphiredoxin 1 homolog (SRXN1), hemeoxygenase 1 (HMOX1), and breast carcinoma amplified sequence 3 (BCAS3) were consistently modulated.
21741353 human POR mutations, shown to impact P450 activities, also result in varying degrees of diminished HO-1 activity, which may further complicate CYPOR deficiency.
21737788 Variation in basal levels of HMOX1 contributes to its response to oxidized palmitoyl arachidonyl phosphatidylcholine (Ox-PAPC), consistent with its position as a hub in this gene network
21729576 mesenchymal stem cells have lower sensitivity to radiation, which may associate with the expression of radioresistant genes survivin and HO-1.
21725851 No significant association between heme oxygenase-1 gene promoter polymorphisms and metabolic syndrome in Iranians.
21647550 The 19G>C-HMOX1 and the -42 + 1444A>G-HMOX2 polymorphisms may be associated with the occurrence and progression of age-related macular degeneration.
21646819 The present study suggests that heme oxygenase 1 regulates blood pressure through CO only when the NOS pathway is fully operative.
21620964 BAY 11-7082 induces protein expression of HO-1 by activating ARE-dependent gene expression through Nrf2 nuclear translocation.
21598088 Data show that constitutive HO-1 expression suppressed mechanical stretch-induced inflammatory responses, suggesting that HO-1 may play a role as a regulation factor in synovial tissue inflammation.
21576421 Severe PE is associated with elevated serum HO-1 levels both antepartum and postpartum.
21556890 study shows for the first time that GT-repeats expansion in promoter of the HO-1 gene is associated with oligospermia and azoospermia among Iranian infertile cases
21555518 HMOX1 is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells.
21552291 these data demonstrate a direct role for p53 in promoting cellular survival in a context-specific manner through the activation of a direct transcriptional target, HO-1.
21545264 data indicate that NGAL exerts its cytoprotective effect independent of HO-1 and protects cells against oxidative stress more efficiently than HO-1
21531452 Higher NQO1 expression was positively associated with upper and lower respiratory symptoms, whereas higher HO-1 expression was inversely associated upper and lower respiratory symptom in adolescents with asthma.
21525764 Increasing HO-1 activity in hHeps protects them from oxidative stress-dependent damage.
21518986 Heme oxygenase-1 may confer protection from hypoxic pulmonary hypertension by effectively modifying the macrophage activation state in hypoxia
21506927 S-guanylation of Keap1 is involved in potent antioxidant effects mediated by 8-nitro-cGMP, by inducing oxidative stress-response genes such as heme oxygenase-1. (Review)
21502755 heme oxygenase-1 has a role in tubulointerstitial inflammatory damage in various renal diseases
21497776 Hsp60 and HO-1 play distinct roles in the pathogenesis of AMI and subsequent AMI-related pathology
21495030 Heme oxygenase-1 germ line GTn promoter polymorphism is associated with pancreatic tumor recurrence.
21454555 Heme oxygenase-1 couples activation of mitochondrial biogenesis to anti-inflammatory cytokine expression.
21426408 Melanocyte expression of heme oxygenase 1 is upregulated, whereas heme oxygenase 2 is reduced in response to UV and bleaching agent 4-TBP.
21425334 This study demonistrated that the interaction between exposure to pesticides and HO-1 (-413, rs2071746) genotypes might be a risk factor for Parkinson disease.
21412259 HO-1 protects human melanocytes from oxidative damage via the Nrf2-ARE pathway.
21389316 HO-1 produced by mesenchymal stem cells beyond its direct suppressive function promotes formation of Tregs and IL-10 production, functions, which are taken over by other molecules, among them COX-2, after an alloreactive priming
21366594 These results indicate a novel pathway by which the defect of PINK1 inhibits the oxidative stress-induced HO-1 production
21354100 Chlorination of high-density lipoprotein induced phosphorylation of p42/44 mitogen-activated protein kinase, expression of transcription factor early growth response 1 and enhanced expression of heme oxygenase-1 in human endothelial cells.
21321939 Enterovirus 71 induces integrin beta1/EGFR-Rac1-dependent oxidative stress in SK-N-SH cells. Up-regulation of HO-1 exerts as a host cellular defense mechanism against EV71 infection in SK-N-SH cells.
21307400 Reveal unique regulatory networks in acute myeloid leukemia whereby FLIP regulation of HO-1 provides cells with secondary anti-apoptotic protection against TNF induced death signals in these highly death-resistant cells.
21296438 HMOX1 is involved in the maturation process and inflammatory response pathways of oxidized low density lipoprotein (oxLDL)-stimulated dendritic cells.
21275653 Association of heme oxygenase-1 gene polymorphisms with essential hypertension and blood pressure in the Chinese Han population
21236443 heme oxygenase-1 promoter GTn repeat polymorphism (GTn) differentiates between benign and malignant pancreatic neuroendocrine tumors and is a strong predictor of tumor recurrence
21233593 The levels of intracellular reactive oxygen species and lipid peroxidation in A549 cells increased with increasing exposure to NiO nanoparticles, and increases in gene expressions of HO-1 and SP-D were observed
21216973 transforming growth factor-beta-stimulated collagen production in fibroblasts is attenuated by quercetin-induced heme oxygenase-1
21211285 LXA(4) upregulates Nrf, NQO1 and HO-1 to protect HUVEC against the oxidative stress induced by LPS.
21206978 Since overexpression of HO-1 promotes angiogenesis in urothelial carcinoma cells, HO-1 inhibitors could be used as novel therapeutics for urothelial carcinoma of the urinary bladder.
21198350 Short (GT)n alleles of the HMOX-1 gene promoter could be a genetic risk factor for hyperbilirubinemia.
21191307 HO-1 polymorphism was not associated with risk of colorectal cancer, suggesting that heme from meat is not important in the development of colorectal cancer.
21174817 The expression of PBMC HO-1 protein and mRNA are significantly increased in asthmatic patients.
21172416 This study highlights the importance of HO-1 as a possible common biomarker for nephrotoxicity.
21157922 In transgenic mice with heme oxygenase-1 glycine143histidine mutation, females present with anemia, enlarged spleen and tissue iron overload, as in HO-1-deficient mice.
21148661 Our results suggest that the HO-1-adiponectin axis may be associated with the regulation of insulin resistance and glucose intolerance in women with PCOS.
21144518 Ginkgo biloba extract might exert its anti-atherogenesis and vascular protective effects by inducing vascular HO-1 expression via Nrf-2.
21136273 a novel role of BMP-6/HO-1 cascade to relieve breast cancer metastasis by regulating the secretion of growth factors in tumor microenvironment.
21113640 HO-1 expression in synovial tissue might be stimulated by inflammatory cytokines.
21091076 A central role of heme oxygenase-1 in cardiovascular protection
21080099 These results imply that DM2 patients and individuals with MS carrying short/medium (SM) genotype of(GT)n repetition in might have higher susceptibility to develop diabetes consequences.
21080099 Observational study of gene-disease association. (HuGE Navigator)
21079975 Heme oxygenase-1 catabolizes most of the heme-Fe and favors iron influx and efflux in intestinal cells.
21037234 The induction of HO-1 mediates the antiapoptotic effect of AMPK, and this may provide an important adaptive response to preserve endothelial cell viability during periods of metabolic stress.
20938987 Curcumin increases HO-1 levels in human skin fibroblasts. The phosphatidylinositol 3-kinase/Akt pathway is involved in curcumin-induced HO-1 expression.
20934533 Cellular iron depletion weakens induction of heme oxygenase-1 by cadmium.
20869265 We found an association between late bacterial infection and genetic polymorphisms of HMOX1, which may control macrophage activation.
20868356 we review recent reports supporting the protective role of HO-1 in cerebral ischemia--REVIEW
20846452 Observational study of gene-disease association. (HuGE Navigator)
20838751 HO-1 is raised in stable coronary artery disease and acute coronary syndromes and may arise from the endothelium but not the platelet.
20832528 Recipients of kidney allograft from donors with HO-1 promoter polymorphisms have siginificantly lower creatinine levels aftr two years
20832528 Observational study of gene-disease association. (HuGE Navigator)
20811623 elevated plasma HO-1 concentrations associated with higher odds ratios for new type 2 diabetes mellitus
20796278 At long term, relatively high levels of arsenic exposure through groundwater, carriers of the short (GT)n allele (< 27 repeats) in the HO-1 gene promoter had a lower probability of developing carotid atherosclerosis than non-carriers.
20796278 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20733275 resistance against anthracyclines correlates with HO-1 expression in non-muscle-invasive bladder cancer
20708634 In a population exposed to arsenic, guanosine-thymidine (GT)-repeat polymorphism in the heme oxygenase-1 gene promoter is associated with cardiovascular mortality risk.
20708634 Observational study of gene-disease association. (HuGE Navigator)
20706680 An HMOX1 (HO-1 gene) enhancer-specific artificial zinc-finger protein (AZP) was designed using bioinformatical methods.
20705711 inhibits autophagy in acute kidney injury
20689807 Observational study of gene-disease association. (HuGE Navigator)
20682519 Persons carrying longer (GT)(n) repeats in the HMOX1 gene promoter may have a higher risk of type 2 diabetes. [REVIEW]
20682519 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
20667089 attachment to Laminin and Fibronectin coated wells. CONCLUSIONS: Collectively, our results show that HO-1 expression determines a distinct 'molecular signature' in cancer cells, which is enriched in genes associated with tumorigenesis
20633528 these data suggest that miR-122 has an inhibitory effect on HBV expression and that miR-122 can down-regulate HO-1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20599261 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20597111 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20585394 results represent the first report on CM genetic risk factors in Angolan children and suggest the novel hypothesis that genetic variants of the TGFB2 and HMOX1 genes may contribute to confer a specific risk of developing the CM syndrome
20585394 Observational study of gene-disease association. (HuGE Navigator)
20580464 expression in M-CSF-polarized M2 macrophages contributes to LPS-induced IL-10 release
20526373 Primary spontaneous pneumothorax in smokers is associated with lung macrophage oxidative stress. The response to this condition involves HIF-1alpha-mediated induction of HO-1, BVR and H-ferritin.
20518850 Taurocholic acid downregulates heme oxygenase activity and expression in human hepatoblastoma cell line (HepG2) stably transfected with the transporter for conjugated bile acids (Ntcp).
20509889 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20508205 The (GT)n promoter polymorphism significantly modulates a cytoprotective, proangiogenic, and antiinflammatory function of HO-1 in human endothelium.
20508205 Observational study of gene-disease association. (HuGE Navigator)
20504881 Parenteral iron formulations differentially affect MCP-1, HO-1, and NGAL gene expression and renal responses to injury.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20482362 orthodontic force-induced osteogenesis in alveolar bone is inhibited by ... the upregulation of heme oxygenase-1 expression
20446774 Nrf2-mediated HO-1 upregulation upon glucose deprivation is mediated by reactive oxygen species in HepG2 cells, and responsible for the adaptive survival response
20430037 These observations support direct and indirect antioxidant properties of BVR and bilirubin and an important role for BVR and bilirubin in HO-1 conferred protection of endothelial cells.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20404253 HO-1 induction in the failing heart is an important cardioprotective adaptation that opposes pathological LV remodeling, and this effect is mediated, at least in part, by CO-dependent inhibition of mitochondria
20395442 These results show that HO-1 is involved in splenic DC differentiation, and/or the homing of CD8(+) splenic DC precursors appears to be dependent on HO-1 expression by the host.
20386498 The HO-1 plasma concentrations are significantly increased among critically ill patients and associated with the degree of organ dysfunction.
20386498 Observational study of gene-disease association. (HuGE Navigator)
20351094 Sp1 regulates chromatin looping between an intronic enhancer and distal promoter of the human heme oxygenase-1 gene in renal cells
20346360 Observational study of gene-disease association. (HuGE Navigator)
20345975 Toluene diisocyanate (TDI) regulates haem oxygenase-1/ferritin expression: implications for toluene diisocyanate-induced asthma.
20345481 Bach1 plays a critical role in regulating HO-1 gene expression in AML cells and its expression suppresses their survival by downregulating HO-1 expression.
20299368 Observational study of gene-disease association. (HuGE Navigator)
20232486 in the United States, among Caucasian or African-American subjects with advanced chronic hepatitis C, genetic variations in the HMOX1 gene promoter are not predictive of responsiveness to antiviral therapy or risks of outcomes of HCV infection.
20229611 These results suggest that Epo induces neural HO-1 expression through the activation of PI3K, MAPK, and Nrf2 pathways, and this may unveil a novel mechanism which mediates the cytoprotective responses elicited by Epo.
20223113 In patients with malignant obstructive jaundice HO-1 was obviously elevated.
20194081 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20193368 alpha-Zearalanol has a potent inhibitory effect on the HO-1 expression and cytosolic free calcium level in HUVECs.
20190330 HMOX1 (heme oxygenase 1) rs5995098, HMOX1 haplotype TTG and GSTP1 (glutathione S-transferase pi) showed significant genetic main effects on annual decline in Forced expiratory flow; reduced exposure to particulates reduced decline
20190330 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20188821 expression in tracheal smooth muscle cells is induced by Cigarette smoke particle-phase extract
20175935 Subjects carrying longer (GT)(n) repeats in HO-1 gene promoter may have greater susceptibility to develop cerebral ischemic only in the presence of low HDL-C, suggesting the protective effects in HO-1 genotype S in the process of ischemic stroke.
20175935 Observational study of gene-disease association. (HuGE Navigator)
20170613 The expressions of Hsp70 and HO-1 in the myocardium of patients with acute myocardial infarction were significantly higher than those in control group.
20155807 These results suggest that mesencephalic HO-1 protein level is regulated by proteasome activity and the elevation by proteasome inhibition affords neuroprotection.
20127796 miR-196 directly acts on the 3'-UTR of Bach1 messenger RNA and translationally represses the expression of this protein, and up-regulates HMOX1.
20121710 In this patient population, short repeat alleles of the HO-1 gene promoter polymorphism were associated with prolonged jaundice.
20110814 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20064636 results show that, compared to normal B lymphocytes, malignant B cells have a greater capacity to increase their HO-1 protein levels in response to 15-deoxy-Delta(12,14)-prostaglandin J(2).
20049130 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20039940 Subjects carrying both the HO-1 (-4rs2071746) TT genotype and the glycogen synthase kinase 3beta (-157, rs6438552) TT genotype have a four times higher risk of developing Parkinson's disease than subjects without these genotypes.
20039940 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20021945 The overexpression of HO-1 in hypoxic HepG2 cells is HIF-1alpha-dependent.
20020468 Upregulation of heme oxygenase-1 inhibits the maturation and mineralization of osteoblasts.
20013271 HO-1 was significantly higher in serum of Henoch-Schonlein purpura patients than in controls.
19965783 Sickle blood increases endothelial heme oxygenase activity.
19925812 These results indicate that the downstream products of HO-1, i.e. bilirubin and CO, modulate BDNF and GDNF expression in neuron and astrocyte.
19924377 investigation of role of HMOX1 in osteogenesis: expression of osteoblast markers in differentiating stem cells under conditions of HMOX1 overexpression or HMOX1 inhibition
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910578 CXCL4 may promote atherogenesis by suppressing CD163 in macrophages, which are then unable to upregulate the atheroprotective enzyme heme oxygenase-1 in response to hemoglobin.
19903769 Results implicate HO-1 in prostate cancer cell migration and proliferation.
19903700 important relationship between PPARdelta, PGC1alpha, and haem oxygenase-1, demonstrating that haem oxygenase-1 induction plays an important role in cytoprotective actions of PPARdelta ligands in vascular endothelium
19895178 HO-1 gene promoter may be associated with the development of ESCC in Chinese male drinkers.
19895178 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19886851 rs9607267 of the HMOX1 gene was significantly associated with essential hypertension (EH) and the Hap3(T-C-G) of the HMOX1 gene was also significantly associated with the risk of EH
19886851 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19884647 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19879747 HO-1 may bind to CD91, thus suggesting its major role as a new chaperokine in immune response regulation.
19874887 induction of expression reduces radiation-induced cell damage in keratinocytes
19853072 HO-1 siRNA decreased HO-1 expression but increased adipocyte stem cell differentiation and the adipogenesis marker, PPARgamma. Thus, upregulation of HO-1 expression shifts the balance of MSC differentiation in favor of the osteoblast lineage.
19850937 Zinc protoporphyrin regulates cyclin D1 expression independent of heme oxygenase inhibition.
19822148 ERK(1/2) and JNK are involved in cigarette smoking-induced biphasic HO-1 expression by a specific regulation of Nrf2/Keap1-Bach1.
19808972 Elevation of heme oxygenase-1 expression is associated with hormone-refractory prostate cancer.
19808663 Data show that induction of HO-1, GCLM, and NQO1 by OA-NO2 Is Nrf2-dependent.
19797297 HO-1 expression by T(regs) might contribute to their typical reluctance to proliferate but does not account independently for their suppressive functions.
19785642 The increase of serum HO-1 levels in Parkinson's disease (PD) patients could indicate a systemic antioxidant reaction related to a chronic oxidative stress state in PD brain.
19777608 iron effects hmox1 expression in hepatoma cells
19696228 These results support an association between the HO-1 (GT)(n) microsatellite polymorphism, HO-1 expression levels, and the odds of type 2 diabetes mellitus.
19696228 Observational study of gene-disease association. (HuGE Navigator)
19676145 heme oxygenase-1, hypoxia inducible factor-1alpha, and ubiquitin are involved in the development and progression of coronary heart disease
19669099 Following dietary intake of broccoli sprouts there is an induction of HO-1 in a transgenic mouse model of prostate cancer.
19625608 HOCl induces HO-1 transcription via activation of the Nrf2/ARE pathway to counteract HOCl-mediated mitochondrial dysfunction and cell death. The ability of HOCl to activate HO-1 gene expression represent adaptive response to maintain endothelium viability
19604147 Our results reveal that H2O2-induced MST3-mediated cell death involves suppressing both a JNK survival pathway and up-regulation of HO-1.
19590927 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19587144 Glomerular epithelial cell-targeted HO-1 expression reduces proteinuria in glomerular immune injury.
19586801 [review] Heme oxygenase-1 inhibits the pathogenesis of several immune-mediated inflammatory diseases. The immunoregulatory actions of HO-1 limit immune-mediated tissue injury thus suppressing the pathogenesis of immune-mediated inflammatory diseases.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19556236 Data suggest that oligomerization, driven by transmembrane segment-transmembrane segment interactions, is crucial for the stabilization and function of HO-1 in the ER.
19548360 The induction of HO-1 protein in response to moderate oxidative stress may explain some of the beneficial pharmacological effects of Notopterygium forbesii.
19536150 HO-1 is functionally expressed by keratinocytes in parallel with epidermal differentiation and that its expression is independently affected by several cytokines
19526463 posttranslational mechanism involving decreases in the cellular heme pool by arsenite-induced HO-1 may contribute to arsenite-mediated downregulation of CYP1A1.
19526221 Investigated the associations of HMOX1 polymorphisms with acute respiratory distress syndrome(ARDS) risk and plasma HO-1 levels
19526221 Observational study of gene-disease association. (HuGE Navigator)
19522732 Decreased CH, increased oxysterol and increased CH precursors concentrations in the cortex correlated significantly with HO-1 levels in MCI and AD, but not no cognitive impairment
19508729 inhibition of HO-1 & chelation of iron in pancreatic cancer cells were associated with increased sensitivity of pancreatic tumors to chemotherapy; metabolites biliverdin & iron seem to be involved in HO-1-mediated resistance to anticancer treatment
19487598 HO-1 induction reverses plaque progression from a vulnerable plaque to a more stable phenotype as part of a compensatory atheroprotective response
19484149 Immunohistochemistry analyses indicated that annexin A11 immunointensity inversely correlated with HMOX1 immunoreactivity in 142 ovarian cancer patients.
19475336 Our analyses did not reveal a significant association of these genetic markers in the HO-1 gene with an increased susceptibility to Parkinson Disease.
19475336 Observational study of gene-disease association. (HuGE Navigator)
19457866 heme oxygenase-1 induction by statins is enhanced in vascular endothelium exposed to laminar shear stress and impaired by disturbed flow
19457084 HO-1 down-regulates alpha-synuclein levels in human neuroblastoma cells by specifically activating proteosomal degradation of alpha-synuclein protein.
19445907 Nrf2 and HO-1 were induced at the early stage after MCAO. Curcumin protected the brain from damage caused by MCAO, this effect may be through upregulation of the transcription factor Nrf2 expression.
19428335 The production of PGE(2) was decreased by HO-1 induction as a result of diminished mPGES-1 protein and mRNA expression.
19422386 The carbon monoxide releasing molecule (CORM-3) inhibits expression of vascular cell adhesion molecule-1 and E-selectin independently of haem oxygenase-1 expression.
19399816 Enhanced oxidative stress and a decrease in the number of anti-oxidant enzymes may be associated with pre-eclampsia.
19389234 our results strongly argue against a relevant role of the (GT)n repeat or the -413A>T SNP in the HMOX1 promoter in coronary artery disese or myocardial infarction
19389234 Observational study of gene-disease association. (HuGE Navigator)
19371606 These findings established an important mechanistic link between the functional monocyte adhesion properties of endothelial cells and the induction of HO-1 by arsenite.
19360326 Inhibition of TNF-alpha-induced gene expression and release of IL-8 and HO-1 in human monocytic THP-1 cells exposed to both volatile anesthetics.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19325051 Qercetin virtually attenuated ethanol-derived oxidative damage via HO-1 induction. Heme degradation and CO release may mediate the protective effects through inhibiting ethanol-induced CYP 2E1 synthesis and enzymatic activity, respectively.
19303319 Data show that particulate matters significantly influenced HO-1 and VEGF gene expressions, caused neutrophilic inflammation and promoted oxidative stress in welders with long-term exposure.
19289500 Data show that nitric oxide (NO) stabilizes mRNA subsets in fibroblasts, that HuR alone is insufficient for stabilizing several mRNAs by NO, and show that heme oxygenase-1 induction by NO is regulated by HuR.
19282863 Observational study of gene-disease association. (HuGE Navigator)
19255829 serum HO-1 (heme oxygenase-1) level in juvenile idiopathic arthritis during the active phase was significantly higher than in patients with other rheumatic disease
19255063 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19250338 findings show that HO-1 activity promotes mitochondrial macroautophagy and sequestration of redox-active iron in astroglia independently of classical iron mobilization pathways
19246912 Our study failed to detect any association between the single nucleotide polymorphisms of the HMOX1 gene and Alzheimer's disease
19246912 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19243105 The active site electronic structure of the azide complex of substrate-bound heme oxygenase 1 has been investigated by NMR spectroscopy to shed light on the orbital/spin ground state as an indicator of the unique distal pocket environment of the enzyme
19243019 Study indicated that the (GT)n repeat polymorphism in the HMOX1 promoter region showed association with serum total bilirubin levels in the Uyghur population.
19243019 Observational study of gene-disease association. (HuGE Navigator)
19238116 Observational study of gene-disease association. (HuGE Navigator)
19236506 Haeme oxygenase-1 could represent an important candidate gene in the pathogenesis and growth of Gastrointestinal stromal tumours .
19236506 Observational study of gene-disease association. (HuGE Navigator)
19194559 HO-1 gene promoter length polymorphism is related to the renal impairment of IgA nephropathy at the time of diagnosis
19194559 Observational study of gene-disease association. (HuGE Navigator)
19165391 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19133325 pulmonary epithelium expression is induced by nitrolinoleic acid via ERK pathway
19129475 HO-1, which is induced by Apoptotic Cell-derived Shingosine-1-Phosphate, is critically involved in an alternative macrophage activation.
19122175 Induction of prostacyclin by steady laminar shear stress suppresses tumor necrosis factor-alpha biosynthesis via heme oxygenase-1 in human endothelial cells.
19120903 Findings are evidence of the induction of HO-1 in the colon of ulcerative colitis patients.
19056482 Observational study of gene-disease association. (HuGE Navigator)
18983509 HO-1 negatively regulates thrombopoiesis by inhibiting reactive oxygen species.
18981090 LPS induces NQO1 and HO-1 expression in human monocytes via Nrf2 to modulate their inflammatory responsiveness
18977241 Observational study of gene-disease association. (HuGE Navigator)
18975324 The aim of this study was to determine whether the (GT)n-repeat length within the HMOX1 promoter region is associated with RA disease severity and radiographic joint damage.
18975324 Observational study of gene-disease association. (HuGE Navigator)
18957281 PGD(2) induces HO-1 mRNA expression through DP2 receptor, linking the PGD(2)-DP2 signaling with heme homeostasis.
18930811 Increased heme oxygenase 1 expression is associated with multiple sclerosis lesions.
18923065 YC-1 stimulates the expression of HMOX1 in vascular smooth muscle cells.
18845641 HO-1 is a negative regulator of trophoblast motility acting via up-regulation of PPARgamma.
18841019 Subjects carrying the HO-1 genotype had a more than 6.5-time higher risk of developing Alzheimer's disease than subjects without these risk genotypes
18841019 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18811919 Heme oxygenase enzyme (HO-1) activity in the human seminal plasma is related to spermatogenesis and sperm-motility processes.
18804049 donor polymorphism leading to high expression of HO-1 (<30 GT repeats) on stress signals is associated with reduced overall survival in hematopoietic stem cell transplantation recipients
18804049 Observational study of gene-disease association. (HuGE Navigator)
18799519 Results suggest that the signals evoked by hypoxia and after ethyl-3,4-dihydroxybenzoate treatment differentially regulate HO-1 mRNA expression through HIF-1alpha-independent mechanisms.
18787101 HO-1 has a significant protective effect against airway mucus hypersecretion in animals and humans exposed to cigarette smoke.
18786476 potentially autoprotective and autodefensive role in several pathophysiological states including acute coronary syndromes and stroke
18774956 HO-1 has a crucial role in maintaining body iron balance
18769149 These studies demonstrated an interdependence of autophagic and apoptogenic signaling in cigarette smoke extract -induced cell death, and their coordinated downregulation by HO-1.
18757839 expression of heme oxygenase-1 in human aortic endothelial cell
18692581 Results suggest that human heme oxygenase-1-modified mesenchymal stem cells prevent myocardial cell injury via secretion of paracrine-acting mediators.
18689604 Glutathione-induced increase in HO-1 may help protect against cigarette smoke-induced inflammation and/or cell death.
18665050 Heme oxygenase-1 expression decreased LPS-stimulated secretion of MCP-1, IL-6, IL-10, and TNF-alpha at both 4 and 24 h in murine and human macrophages
18651163 mRNA expressions of Hsp70, Hsp32 and Bax significantly increased in mononuclear blood cells after marathon running, whereas Hsp27 and Bad mRNA expression levels showed no significant changes.
18640487 No association was detected between the TGFB1, IL10, TP53, and HMOX1 genes and DGF. The G allele of the TNF polymorphism rs3093662 was associated with DGF in an adjusted analysis.
18640487 Observational study of gene-disease association. (HuGE Navigator)
18620357 The association of HO-1 overexpression with a greater extent of intraplaque angiogenesis suggests a multi-faceted role for HO-1 in modulating the progression of atherosclerosis
18597895 Subjects carrying both the HO-1 (-413) TT genotype and the LXR-beta (intron 2) TT genotype, LXR-beta (intron 5) AA genotype or LXR-beta (intron 7) TT genotype, had a higher risk of developing AD than subjects without these risk genotypes.
18597895 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18596041 CO, a product of heme catabolism by HO-1, directly inhibits alpha1C subunit of the cardiac L-type Ca2+ channel
18587252 Significantly different distribution of the HO-1 genotype was found in subjects with different-stage urothelial carcinomas; however, it was not related to the NAD(P)H:quinone oxidoreductase 1 genotype.
18586007 These results demonstrate for the first time that epigallocatechin-induced HO-1 expression occurs via PKCdelta and Nrf2.
18582925 HO-1 levels were increased in sera and skin lesions of patients with atopic dermatitis and were associated with disease severity
18576916 HO-1 protects endothelial cells from apoptosis, is involved in blood-vessel relaxation regulating vascular tone, attenuates inflammatory response in the vessel wall, & participates in blood-vessel formation via angiogenesis & vasculogenesis. Review.
18566988 specific knockdown of HO-1 might represent a novel therapeutic approach in hepatocellular carcinoma therapy.
18560362 REVIEW of role of HO-1 in protecting against vascular injury
18550526 Loss of BACH1 function in human keratinocytes results almost exclusively in HMOX1 induction, suggesting that BACH1 may function as a rheostat regulating levels of intracellular free heme.
18544348 HO-1 protein turnover is regulated by the ubiquitin-proteasome system through the endoplasmic reticulum-associated degradation pathway
18524839 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18515325 Down-regulation of HO-1 expression in neutrophils from hypertensive subjects may be exerted through the inhibition of NOS2 expression.
18508827 haem oxygenase-1 plays a central role in NNK-mediated cell proliferation by promoting the expression of p21(Cip1/Waf1/Cid1), inhibitor of apoptosis protein 2 and B-cell lymphoma-2 but inhibiting the activity of Bad
18502573 genetic polymorphisms of HO-1 and iNOS modulate individual susceptibility to gastric cancer risk.
18502573 Observational study of gene-disease association. (HuGE Navigator)
18483307 beneficial role of HO-1 in blocking tumor invasion was first identified in this study.
18461097 association between cardiac response to submaximal exercise and HMOX-1 genotype
18461097 Observational study of gene-disease association. (HuGE Navigator)
18460015 Observational study of gene-disease association. (HuGE Navigator)
18459998 Improved renal function after kidney transplantation is associated with heme oxygenase-1 polymorphism
18459998 Observational study of gene-disease association. (HuGE Navigator)
18443197 Polymorphism in the HO-1 gene promoter is correlated with susceptibility to coronary artery disease in diabetic patients.
18443197 Observational study of gene-disease association. (HuGE Navigator)
18404535 chlorophyllin exerts antioxidant effect by inducing HO-1 and NQO1 expression mediated by PI3K/Akt and Nrf2
18390757 Enterohemorrhagic Escherichia coli-induced heme oxygenase-1 in human epithelial cells is a critical modulator of the innate immune response.
18381758 Overexpression of HO-1 releasing molecules may provide a therapeutic strategy to improve cell viability during neural differentiation in applications that use stem cell technology.
18344023 Inhibition of plasminogen activator inhibitor-1 expression in vascular smooth muscle cells by protoporphyrins through a heme oxygenase-independent mechanism.
18332044 The expression level of HO-1 gene is a marker for Cr(VI)-induced cell stress leading to cytotoxicity.
18312299 Presence of short GTn-allele was associated with a lower tumor recurrence rate and better relapse-free survival in OSCC patients. HMOX-1 promoter polymorphism might be considered as a potential prognostic marker in OSCC patients.
18307065 Increased decidual and serum HMOX1 levels, together with altered decidual expression of some stress-related genes in cases, support the role of oxidative stress and excessive maternal inflammatory response in the pathogenesis of PE.
18275848 HO-1 upregulation by SAM was causally related to a decrease in NADPH-mediated production of oxygen radicals. Our results demonstrate that the HO-1/ferritin-system is a novel target of the antioxidant compound S-adenosylmethionine.
18274635 human blood ozonation induces a remarkable upregulation of heme oxygenase-1 and heat stress protein-70
18272347 HO-1 was correlated with the degree of epithelial dysplasia. Oral squamous cell carcinoma also showed elevated expression of HO-1, but this level was not higher than in severe OED or carcinoma in situ.
18261117 Higher levels of HMOX1 is associated with delayed graft function.
18234118 Upregulated TLR4 is associated with HO-1 reduction in peripheral blood monocytes from patients with Behcet's disease, leading to augmented inflammatory responses.
18216050 The expression of haem oxygenase-1 is decreased in macrophages of idiopathic pulmonary fibrosis patients compared with those with granulomatous lung disorders
18205746 plays a principal role in the protective response to nicotine in oral cancer and immortalized keratinocytes
18202225 a novel mechanism by which TNF-induced cell death is inhibited in AML cells through the induction of HO-1, via Nrf2 activation.
18201862 Patients with a first venous thromboembolism and long GT-repeat alleles in HMOX1 have an increased risk of recurrence.
18201862 Observational study of gene-disease association. (HuGE Navigator)
18200441 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18195184 REVIEW: overview of the role of heme oxygenase-1 and carbon monoxide in angiogenesis, and associated disorders.
18174022 Thus, PGD(2) may contribute to the maintenance of heme homeostasis in the brain by inducing HO-1 expression.
18093274 HO-1 genotype mediates graft survival after liver transplantation
18093274 Observational study of gene-disease association. (HuGE Navigator)
18077487 Glucosamine sulfate up-regulated expression of HO-1 in human osteoarthritis chondrocytes.
18050210 HO-1 (GT)(n) microsatellite is a new genetic marker involved in rheumatoid arthritis genetics.
18048809 Functional promoter variants in CAT and HMOX-1 showed ethnicity-specific associations with new-onset asthma.
18045827 the functional HO-1 promoter polymorphism does not influence renal survival in CKD due to ADPKD or IgAN
18042465 Based on these results, we conclude that HO activity is involved in the regulation of p53 expression in a ROS-independent mechanism.
18007994 A significant association was found between oxidative stress GSTM1 deletion and the HMOX-1 long repeat and heart rate variation in response to particulate air pollution.
17991645 Observational study of gene-disease association. (HuGE Navigator)
17991645 Microsatellite polymorphism in the heme oxygenase-1 gene promoter is associated with iron status in persons with type 2 diabetes mellitus.
17971338 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17971338 The results suggest that high levels of beta-carotene might counterbalance the effects on FEV1 decline determined by heme oxygenase-1 gene promoter polymorphism.
17964723 These results suggest that HO-1 modulates the inflammatory pain pathways. Hence, the development of drugs that could raise peripheral HO-1 could be relevant in inflammatory pain treatment.
17953374 A20 and HO-1 may play protective role in acute graft rejection.
17927807 Atorvastatin-mediated HO-1 upregulation, and its associated antioxidant effect, are KLF2-dependent.
17919492 micro-RNA-122 (miR-122) plays an important role in the regulation of hepacvirus replication and heme oxygenase-1/Bach1 expression in hepatocytes.
17919491 HO-1 showed a pronounced antiviral activity in hepatitis B virus infection.
17915953 hHO-1 has the potential to incorporate into phospholipid membranes, which can be reconstituted at known concentrations, in combination with other endoplasmic reticulum resident enzymes
17896171 Continuously elevated HO-1-activity protects EC from oxidative stress but inhibits Akt-mediated proliferation and eNOS-expression. This inhibitory feedback mechanism could be a limitation of HO-1 as a target for the treatment of vascular disease.
17886034 heme oxygenase-1 increases in human lymphocytes after exercise
17883332 Targeting endothelial cells with HO-1 using VE-cadherin promoter attenuates hyperglycemia-mediated cell injury and apoptosis.
17873285 stress-induced HO-1 initially plays a protective role, while its chronic upregulation, might contribute to oligodendroglial cell death rather than providing protection
17853070 Anticipation of subsequent demanding exercise increases the expression of haem oxygenase-1 mRNA in human lymphocytes.
17823375 carbon monoxide renders endothelial cells resistant to stress by upregulating Nrf2-dependent HO-1 expression via PERK activation
17726138 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17726138 potentially higher levels of iron-generated oxidative stress related gene alleles may be at increased risk of breast cancer
17721824 These data suggest that HCV core protein may contribute to hepatocellular injury by increasing both steady-state levels of prooxidants and the susceptibility of hepatocytes to damage by impairing their response to other sources of oxidative stress.
17667816 Heme oxygenase-1 (HO-1) gene transcript in the donor hearts was up-regulated with D-4F treatment, and HO-1 blockade partially reversed the beneficial effects of D-4F.
17657593 Isothiocyanates activate antioxidant response element(ARE)-mediated HO-1 gene transcription through Nrf2/ARE signaling pathway.
17652371 HO-1 can regulate the expression of the anti-angiogenic CXCL-10 and may alter a critical balance between angiogenic vs. anti-angiogenic factors that are important to maintain renal microvasculature during injury.
17620093 Suppression of antigen-presenting cells may represent a main anti-inflammatory mechanism of HO-1
17603281 Curcumin has an ability to induce HO-1 expression, presumably through Nrf2-dependent ARE activation, in rat VSMCs and HASMCs
17601350 Observational study of gene-disease association. (HuGE Navigator)
17600318 Inhibition of HO-1 function or expression further increases the proproliferative capacity of pulmonary artery smooth muscle cells.
17567933 The molecular regulation of heme oxygenase-1 by transforming growth factor-beta1 in human renal proximal tubular cells is reported.
17558910 study shows HO-1 expression rate of 41.8% in colorectal cancer & 36.8% in colon adenoma; expression associated with lower rate of lymphatic invasion & tendency of fewer lymph node metastases; patients with HO-1 expressing colon cancer had better survival
17541213 the capacity to upregulate HO-1 expression may be determined, at least in part, by genetics, and reduced ability to induce HO-1 may be involved in the mechanism of coronary atherosclerosis
17531161 Induction of heme oxygenase-1 in renovascular hypertension is associated with inhibition of apoptosis.
17526500 BAX inhibitor 1 functions involve the expression of heme oxygenase-1 (HO-1) through nuclear factor erythroid 2-related factor 2.
17526019 In Parkinson's disease brain, overexpression of HO-1 in nigral astroglia and accompanying iron liberation may facilitate bioactivation of dopamine to neurotoxic free radical intermediates and predispose nearby neuronal constituents to oxidative damage.
17520317 Observational study of gene-disease association. (HuGE Navigator)
17520317 The findings suggest that the long (GT)n repeat of HO-1 was associated with a greater frequency of gastric adenocarcinoma.
17511591 Inhibition of HO-1 significantly increases T cell proliferation against human embryonic stem cells
17467999 These results suggest that HO-1 transgene expression regulated by an enhanced GFAP promoter selectively increases HO-1 expression in astrocytes, and is cytoprotective
17452746 We have identified novel nonclassical mediators of the SREBP-1 response, including HMOX1, supporting the hypothesis that SREBP-1 regulates stress response and signaling genes.
17413033 HO-1 expression is transcriptionally regulated by PPAR-alpha or PPAR-gamma.
17400606 Observational study of gene-disease association. (HuGE Navigator)
17400606 The findings of this study does not support a clinically relevant association of the HO-1 promoter polymorphism with restenosis and ischaemic events after coronary stenting.
17391133 Observational study of gene-disease association. (HuGE Navigator)
17391133 No evidence of any protective effect for the S-allele of the HO-1 gene promoter polymorphism on graft or recipient survival in renal transplantation.
17389623 As highlighted in this review, HO-1 can be a potent protector; in other circumstances, a seemingly disinterested bystander; and in still others, a pernicious perpetrator of cellular damage.
17295091 Increased HO-1 in premature senescence of fetal lung fibroblasts induced by both tert-butylhydroperoxide and ethanol.
17277740 Both vitreous and TGF-beta signals increased HO-1 expression in retinal pigment epithelial cells via reactive oxygen species.
17254481 Observational study of gene-disease association. (HuGE Navigator)
17244614 HSF1 is directly involved in the regulation of HO-1 with an anti-oxidative role
17229906 The main catabolic process that degrades heme, the heme oxygenase (HO) system, is reviewed, and evidence for the protective effects of HO-1 against acute and chronic heme/heme protein-induced renal injury is summarized. [REVIEW]
17219054 Results indicate that stimulation of heme oxygenase-1 expression by hypericin-PDT is a cytoprotective mechanism governed by the p38(MAPK) and PI3K pathways.
17216339 Expression of heme oxygenase 1 (HO-1) correlated with CD4+ CD25+ FoxP3+ (Treg)infiltration. HO-1 expressing Treg accumulate during glioma progression. HO-1 mRNA expression is linked to the induction of Foxp3 in CD4+ CD25+ glioma infiltrating Treg.
17211576 The basal levels of Hsp32 (HMOX1), Hsp70 and Hsp90 increased significantly with age in controls. Higher levels of Hsp32, Hsp70 and Hsp90 were noticed in patients with inflammation.
17204476 JunB and JunD contribute opposing effects; JunB activated whereas JunD repressed heme oxygenase-1 expression in human renal epithelial cells
17203192 Observational study of gene-disease association. (HuGE Navigator)
17203192 Genetic polymorphisms in HOX-1 and mEPH genes are associated with the development of COPD in Southwest China
17095719 symptomatic plaques show a more pronounced induction of CD163 and HO-1 in response to plaque hemorrhages.
17079780 We demonstrate the functional compartmentalization of heme oxygenase-1 in the mitochondria of lung epithelial cells, and its potential role in defense against mitochondria-mediated cell death during CSE exposure.
17065227 The effect of Bach1 and Nrf2 on heme oxygenase 1 expression via cobalt protoporphyrin in human liver cells is reported.
17064313 heme oxygenase-1 is down regulated by heme oxygenase-2.
17020887 lipid peroxidation is a significant cause of NO-induced necrosis in human lung epithelial cells, but increased NO survival of rat cells is due to decreased lipid peroxidation mediated by HO-1-generated biliverdin or bilirubin
17018862 Bach2 is phosphorylated on S521 via Bcr-Abl signaling thru the phosphatidylinositol-3/S6 kinase pathway,and transcriptionally represses heme oxygenase-1
17018578 Inhibition of HO1 by Motexafin gadolinium may contribute to its anticancer activity.
17003650 HO-1 gene overexpression in rat islets by adenovirus transduction can protect cultured islets against recombinant TNF-alpha and cycloheximide-mediated cytotoxicity.
16999951 HO-1 expression and activity in endothelial cells are present only in advanced atherosclerosis, whereas VEGF expression is present in early as well as in advanced atherosclerosis and the degree of expression increases with severity of atherosclerosis.
16971418 HO-1 and carbon monoxide require endothelial STAT3 for their protective effects, and STAT3 confers endothelial cell protection via both HO-1-dependent and independent mechanisms
16951197 Sulforaphane transcriptionally activates the upstream ARE-rich enhancer region, located at -9.0 kb upstream human HO-1 promoter.
16950787 nuclear factor (erythroid-derived 2)-like 2-mediated HO-1 overexpression confers resistance to apoptosis induction by EGCG
16945925 up-regulation of HO-1 by non-steroidal anti-inflammatory drugs (NSAIDs) is mediated through NSAID-dependent activation (phosphorylation) of p38 mitogen-activated protein kinase
16923960 These results thus demonstrate that BRG1, through the facilitation of Z-DNA formation and subsequent recruitment of RNA polymerase II, is critical in Nrf2-mediated inducible expression of HO-1.
16887359 In Alzheimer disease brain, alpha(1)-antitrypsin immunoreactivity was augmented and co-distributed with heme oxygenase-1
16882737 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16882737 These results suggest that a long (L) HO-1 gene promoter in heavy smokers is associated with susceptibility to develop airway obstruction.
16849502 The antiapoptotic effect of HO-1 in endothelial cells is dependent on the degradation of p38alpha MAP kinase isoform by the 26S proteasome and on the expression of p38beta MAP kinase.
16840713 HO-1 and Akt exert codependent cytoprotective effects against oxidative stress-induced apoptosis in human aortic smooth muscle cells.
16804400 anti-inflammatory actions mediated by gliotoxin include HO-1 induction and the subsequent blockade of NF-kappaB-dependent signaling pathways in vitro and in vivo
16783602 early thrombolysis induced by CO in HO-1-mediated protection against intimal hyperplasia after vascular injury
16772700 The adaptation of HO-1 mRNA expression assay as a biologically relevant indicator of cigarette smoke-induced stress.
16771696 Data show that beta-carotene, combined with cigarette smoke condensate (TAR), regulates heme oxygenase-1 (HO-1) via its transcriptional factor Bach1 and modulates cell growth.
16724942 The focus of this review is on the importance of the stress-responsive heme oxygenase-1 induction system as a cytoprotective program.
16712795 proton pump inhibitors induce heme oxygenase-1 in gastric and endothelial cells
16697692 Our results support an antiapoptotic role for HO-1 in Caco-2 cells and provide a mechanism by which overexpression of HO-1 may promote tumor resistance to stress in conditions of limited nutrient supply.
16620829 atorvastatin prevents hypoxia-induced inhibition of endothelial nitric oxide synthase expression but does not affect heme oxygenase-1 in human microvascular endothelial cells
16609364 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16596642 Observational study of gene-disease association. (HuGE Navigator)
16596642 Microsatellite polymorphism in the heme oxygenase-1 gene promoter is associated with risk for melanoma
16582079 Observational study of gene-disease association. (HuGE Navigator)
16582079 The large size of a (GT)n repeat in the HO-1 gene promoter may be associated with susceptibility to pneumonia in the older Japanese population.
16545694 Treatment of keratinocytes with hemin induced HO-1 expression & activity. Involvement of HO-1 in VEGF synthesis was confirmed by inhibition of VEGF expression by SnPPIX, blocker of HO activity & by attenuation of HO-1 mRNA expression with specific siRNA.
16540907 expression of HO-1, but not HO-2, was upregulated within the nasal tissues in allergic rhinitis inflammation, and understanding the induction of HO-1 expression may provide for better management of allergic rhinitis that involves oxidative stress.
16530877 key role of down-regulation of Bach1 and up-regulation of heme oxygenase 1 in diminishing cytotoxic effects of hepatitis C virus proteins in human hepatocytes.
16495813 Curcumin induces HO-1 in human hepatocytes, and may show protective effects in pretreatment during hepatic transplantation.
16485041 Heme oxygenase-1 plays a vital role in the inhibition of vaso-occlusion in transgenic sickle mice.
16474202 Induction of HO-1 inhibits MCP-1 mRNA expression in U937 cells.
16462769 HO-1 is involved in an important protective mechanism against PDT-mediated phototoxicity
16455537 Observational study of gene-disease association. (HuGE Navigator)
16399210 Glial HO-1 expression in the MCI temporal cortex and hippocampus was significantly greater than in the non-demented group and did not differ from AD values.
16387424 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16387424 Oral squamous cell carcinoma with lymph node metastasis or advanced stage had significantly higher frequency of HO-1 L allelotypes.
16374439 Observational study of gene-disease association. (HuGE Navigator)
16319139 HO-1/IDO cross-regulation modulates apoptosis and proliferation in rat and human breast cancer cells
16313248 Observational study of gene-disease association. (HuGE Navigator)
16309588 oxidation of hemoglobin to methemoglobin by low-density lipoprotein (LDL)-associated lipid hydroperoxide and increased sensitivity of cells of the HO-1-deficient child to stress of oxidized LDL might contribute to the vascular disorders reported earlier
16309586 In HO-1 overexpressing cells, VEGF and the prostaglandin transporter were greatly increased while monocyte chemoattractant protein-1 levels were decreased
16309585 HO-1 induction and activity may modulate the production of extracellular matrix components and suggest a potential role for transforming growth factor-beta-mediated HO-1 induction in attenuating renal fibrosis
16271489 superoxide secondarily generated from damaged mitochondria, not hydroxyl radicals generated in medium directly by sonication, give rise to intracellular oxidative stress inducing HO-1 expression
16249618 Observational study of gene-disease association. (HuGE Navigator)
16249618 short (GT)n alleles represent a genetic risk factor for cerebral malaria
16234431 HO-1 negatively regulates osteoclastogenesis, leading to a positive net balance of bone
16232329 Observational study of gene-disease association. (HuGE Navigator)
16210136 Observational study of gene-disease association. (HuGE Navigator)
16189191 renal expression of HO-1 is regulated in a segment-specific manner, with HO-1 thereby playing distinct roles in different segments of the nephron to maintain renal functions
16181102 Expression of HO-1 in G0/G1 cells may be a key player in decreasing cellular heme, associated with increased generation of bilirubin, and in attenuating glucose mediated oxidative stress.
16154535 The mechanism of heme oxygenase-1 cytoprotection in hepatocytes involves the generation of carbon monoxide and adenosine triphosphate.
16123320 alpha-lipoic acid induces HO-1 expression in THP-1 monocytic cells via Nrf2 and p38
16117883 Observational study of gene-disease association. (HuGE Navigator)
16100019 HO-1 is expressed in carotid atherosclerotic plaques infected by Helicobacter pylori
16020495 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15964514 activation of PKC, p38(MAPK), JNK, ERK1/2, and Nrf2 by oxidized LDL in human smooth muscle cells leads to HO-1 induction, constituting an adaptive response against oxidative injury that can be ameliorated by vitamin C
15899048 Serum levels of heme oxygenase-1 are significantly higher in patients with active hemophagocytic syndrome and adult-onset Still's disease than in sera from patients with other diseases that may cause hyperferritinemia.
15897578 High HO-1 levels in pancreatic cancer calls may be responsible for their anticancer therapy resistance and may act as an endogenous protection mechanism initiated during carcinogenesis
15885363 Observational study of gene-disease association. (HuGE Navigator)
15878918 Increased HO-1 expression, mainly in Leydig cells, is considered to protect the cells against oxidative stresses in varicocele testes.
15875813 heme oxygenase-1 is induced by exercise in human lymphocytes
15849554 ischemia-reperfusion injury and excessive shear stress secondary to portal hypertension might augment HO-1 expression in the graft liver
15834587 findings suggest that the nitric oxide (NO)/ heme oxygenase-1 (HO-1) system has protumoral effects
15833736 transcriptional induction of HO-1 gene expression by AEBSF is mediated via activation of a PKB, p38 MAPK signaling pathway
15817713 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15805230 HIF-1 activation induces substantial HO-1 expression that is associated with attenuated proinflammatory chemokine production by microvascular endothelium in vitro and in vivo.
15797755 The functional promoter repeat polymorphism (GT)(n)has no influence of on the development of heart failure, graft survival, acute rejection, or transplant atherosclerosis.
15797262 There was increased HMOX1 expression in infarcted rat hearts following human bone marrow mesenchymal cell transplantation.
15763346 The induction of HO-1 is an adaptive response against oxidative damage elicited by lipid peroxidation and it may be critical in the progression of non-alcoholic fatty liver
15741166 BVR advances the role of HO-1 in cytoprotection and affords cytoprotection independent of heme degradation
15690204 Fine tuning of previously noted active-site hydrogen-bonding network is critical in determining whether heme oxygenase or peroxidase activity is observed.
15688187 Observational study of gene-disease association. (HuGE Navigator)
15688187 These findings suggest that the large size of a (GT)(n) repeat in the HO-1 gene promoter may be associated with the development of lung adenocarcinoma in Japanese male smokers.
15661856 results provide a molecular cascade showing nitric oxide-Heme oxygenase(HO)-1-vascular endothelial growth factor (VEGF)-interleukin-8 sequence in human endothelial cells
15652505 Foxp3 induces HO-1 expression and HO-1 engages in Foxp3-mediated immune suppression
15629867 The heme oxygenase-1 expression is in humans pulmonary epithelial cells.
15618017 It is possible that HSF-1 negatively regulates HO-1 gene expression, and that the consensus heat shock element present in the -389 to -362 region mediates HSF-1-induced repression of HO-1 gene expression.
15611319 Hemin induced heme oxygenase-1 provided a cytoprotective effect on apoptotic monocytes, despite caspase-3 up-regulation.
15581622 Results provide the first evidence for a role of the survival kinase Akt in the regulation of heme oxygenase-1.
15547665 HO-1 in the liver of acute liver failure patients was highly up-regulated at both transcriptional and protein levels
15544924 Statins lead to HO-1 promoter activation, transcript and protein accumulation
15525643 heme oxygenase shows differential NADPH- and ascorbate-dependent heme cleavage by the R183E mutant
15522396 A network of water molecules, which provide the required protons to activate the iron-oxy complex of heme-HO-1, is absent in both ferrous-verdoheme and the verdoheme-nitric oxide structure.
15519649 HO-1 induction protected human hepatocytes against warm and cold hypoxia.
15474356 HO-1 protects astrocytes from heme-mediated oxidative injury. Specifically increasing astrocytic HO-1 by gene transfer may have a beneficial effect on hemorrhagic CNS injury.
15470195 HO does not exert a pro-oxidant effect involving an non transferrin bound iron increase and that, on the contrary, it could exert an antioxidant effect in premature infants
15465821 Bach-1 has a specific and selective ability to repress expression of hepatic heme oxygenase-1
15451051 Review. Promoter polymorphisms in the HO-1 gene exert functional importance by influencing the level of HO-1 expression in different organ systems.
15365571 Observational study of gene-disease association. (HuGE Navigator)
15365571 Polymorphism in heme oxygenase-1 (HO-1) promoter is related to the risk of oral squamous cell carcinoma occurring on male areca chewers
15337692 HO-1 mediates the antiinflammatory and antiproliferative effects of simvastatin in VSMCs.
15336443 oxidative stress and p38 MAPK as two consecutive early signals promoting HO-1 induction in hepatic myofibroblasts
15319861 decreased expression of HO-1 in hepatocytes from hepatitis C virus-infected patients; expression of HO-1 was also reduced in cell lines that stably express HCV core protein, suggesting that core gene products are able to regulate the expression of HO-1
15316927 study suggests HO-1 is involved in the inhibitory mechanism of flavonoids on LPS-induced iNOS and NO production.
15297453 heme oxygenase oxidation of 5- and 15-phenylhemes involves an electrophilic oxidation mechanism and stereochemical control of the reaction regiospecificity
15285018 struct-activity relationship of the enzyme
15284058 Upregulation of HO-1 decreases oxidant production and endothelial cell damage and shedding and may attenuate vascular complications in diabetes.
15233805 These results indicate that retinal pigment epithelium cells maintain retinal homeostasis by repressing or inducing the expression of heme oxygenase-1, depending on the microenvironment.
15184199 The induction of HO-1 in patients with cystic fibrosis is a cytoprotective event and augmenting its expression is a potential therapy against bacterial injury.
15166181 Overexpression of recombinant human HO-1 in rats brings about a reduction in pressor responsiveness to Ang II, likely due to increased generation of an HO-1 product, presumably CO, with the ability to inhibit vascular reactivity to constrictor stimuli.
15161530 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15140586 Observational study of gene-disease association. (HuGE Navigator)
15140586 Short GT repeats in the HO-1 gene promoter region confer a reduced risk for cerebrovascular events in individuals with normal plasma lipid levels.
15084931 An influence of the HO-1 gene promoter polymorphism on kidney allograft function, thus supporting previous studies indicating a protective effect of HO-1 induction in organ transplantation.
15064108 Observational study of gene-disease association. (HuGE Navigator)
15064108 The AA genotype of HMOX1 reduced the incidence of ischemic heart disease, possibly due to the expression level of HMOX1.
15049686 Study of the crystal structure of human HO-1 in complex with biliverdin provides insight into the final step in the heme degradation pathway--the rate-limiting step in HO-1 catalysis, which is product, biliverdin, release.
15028349 Observational study of gene-disease association. (HuGE Navigator)
15024026 heme oxygenase-1 gene expression is induced by 15-deoxy-delta 12,14-prostaglandin J2 in a reactive oxygen species-dependent manner in human lymphocytes
15004156 Recombinant adenovirus-mediated HO-1 overexpression in cultured HUVEC umbilical vein endothelial cells inhibits E-selectin and VCAM-1, but not ICAM-1 expression.
14992466 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14988408 ATF2 and HO-1 are regulated and induced by biliverdin reductase
14981149 Observational study of gene-disease association. (HuGE Navigator)
14733911 heme oxygenase-1 and ferritin are possible mediators in the antioxidant action of L-alanine
14726403 HO-1 mRNA and protein are up-regulated in KSHV-infected cultures. Comparison of oral and cutaneous AIDS-KS tissues with normal tissues revealed that HO-1 mRNA and protein were also up-regulated in vivo
14715242 We conclude that induction of HO-1 by 15d-PGJ(2) results in augmentation of VEGF synthesis in normoxia.
14691581 Observational study of gene-disease association. (HuGE Navigator)
14691581 heme oxygenase-1 has a role in regulating bilirubin and HDL levels but not in coronary artery disease
14683741 Observational study of gene-disease association. (HuGE Navigator)
14660632 NMR investigation of the solution structure of substrate-free human heme oxygenase
14647439 how HO-1 and WAF1/Cip1 were regulated in two gastric cancer cell lines
14635185 These findings identify an array of gene responses to overexpression of human heme oxygenase (HO)-1 and elucidate new aspects of human HO-1 signaling involved in cell growth.
14615405 regulation of HO expression in the human placenta is a complex process that depends, at least in part, on local glucose and oxygen concentrations.
14587309 Right ventricle of patients undergoing congenital cardiac surgery differentially expresses haem oxygenase-1 and heat shock protein 70 genes
14529548 This review reaffirms current problems in the biological aspects of HO-1 and suggests an anti-atherogenic role for the enzyme.
14523007 identified signal pathways and a cAMP-responsive element and a Maf recognition element involved in oxidized phospholipid-mediated HO-1 induction
14521259 Observational study of gene-disease association. (HuGE Navigator)
13678532 Exogenously applied bilirubin and carbon monoxide mimicked the inhibitory effect of heme oxygenase-1 on the chemotactic response
12969148 Collectively, these results indicate that HO-1 is an important protective factor for kidney tissue, in particular, renal tubular epithelial cells.
12947311 Induction of HO-1 by hemin results in inhibition of proinflammatory response of endothelial cells, as evidenced by inhibition of IL-8 production without affecting PGI(2) production.
12941774 Basal expression of both HSP72 and HO-1 mRNA were lower (P < 0.05) by 33 and 55%, respectively, when comparing diabetic patients with age-matched and young control subjects
12933701 Heme oxygenase-1 expression attenuates glucose-mediated cell growth arrest and apoptosis in vascular endothelium.
12927819 Inducibility of HO-1 in G(0)/G(1) phase is essential and probably regulated by a complex system involving oxygen species to assure controlled cell growth
12927812 HO-1 has a role in preventing cellular injury via antioxidant mechanisms with aspirin
12891549 Heme oxygenase-1 is an antifibrogenic protein in human hepatic myofibroblasts.
12872043 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12872043 The AA genotype of HMOX-1 is associated with an increased incidence of hypertension in women
12865654 there is differential regulation of HO-1 gene expression in parenchymal and non-parenchymal human liver cells
12842469 we report the D140A mutant crystal structure in the Fe(III) and Fe(II) redox states as well as the Fe(II)-NO complex as a model for the Fe(II)-oxy complex.
12832044 induction by endogenous nitric oxide
12810075 Data show that human CD4(+)CD25(+) regulatory T cells constitutively express heme oxygenase-1 (HO-1) and that HO-1 inhibits Jurkat T cell proliferation.
12805077 Elucidation of the molecular mechanisms which control HO-1 gene expression will allow us to develop therapeutic strategies to enhance the cytoprotective potential of HO-1 in atherosclerosis.
12783778 Elucidation of an internal enhancer element regulating induction of this enzyme
12777398 heme oxygenase 1 is induced by P4502E1 through ERK MAPK pathway
12736395 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12736395 polymorphic (GT)n repeats in the promoter region are not related to neonatal hyperbilirubinemia
12730098 polymorphism of the HO-1 gene is associated with the strength of antiapoptotic effects of HO-1, resulting in an association with susceptibility to oxidative stress-mediated diseases.
12716475 heme oxygenase activity up-regulates VEGF production and augments the capability of endothelial cells to respond to exogenous stimulation
12709592 Data suggest that heme oxygenase-1 may be involved in intestinal cell cycle progression.
12709590 Results suggest that stimulation or overexpression of heme oxygenase-1 attenuates DNA damage caused by exposure to angiotensin II.
12709569 Results demonstrate that upregulation of heme oxygenase-1 was able to attenuate pyrrolidinedithiocarbamate (PDTC)-mediated cell proliferation, but was unable to reverse the PDTC-induced decrease in angiogenesis in vascular endothelial cells.
12709568 Data suggest that heme oxygenase-1 gene overexpression may be related to decrease in blood pressure through reduction of the vasodilator 20-hydroxyeicosatetraenoic acid in the urine.
12709566 These results demonstrate that heme oxygenase-1 operates through distinct molecular mechanisms to confer cytoprotection in the hypoxic and the LPS models of inflammation.
12690112 antiproliferative effect of the HO-1 pathway in airway smooth muscle in vitro and in vivo through a bilirubin-mediated redox modulation of phosphorylation of ERK1/2
12679469 decompensated type 2 diabetes is associated with increased NADPH oxidase subunit p22(phox) and hemeoxygenase-1 gene expressions in circulating monocytes
12649161 HO-1 expression occurs in human epidermias and infiltrating leukocytes of patients with chronic inflammation. The basal level of HO expression in the skin may serve as a first protective environment against acute oxidative and inflammatory insults.
12626517 determination of binding sites on cytochrome P450 reductase and biliverdin reductase
12585963 gene induction by glucose deprivation is mediated by reactive oxygen species via the mitochondrial electron-transport chain
12579334 Observational study of gene-disease association. (HuGE Navigator)
12579334 Polymorphism in HMOX1 might be associated with development of emphysematous changes in the lung.
12566526 Observational study of gene-disease association. (HuGE Navigator)
12500973 comparison of heme-gree and -bound crystal structures
12493432 This enzyme is expressed in heart transplant recipients during acute rejection episodes.
12480749 gene expression regulation used as a possible assessment for antioxidant capacity in Alzheimer's disease
12469218 CYP2E1 overexpression up-regulates both non-specific delta-aminolevulinate synthase and this enzyme in a human hepatoma cell line.
12433915 HO-1 has a specific conformation that allows tight binding to nitric oxide, which may contribute to the pleiotropic responses to NO and CO
12431619 This enzyme is expressed in heart transplant recipients during acute rejection episodes, along with apoptosis.
12397597 HO-1 mitigates the TNF-alpha-mediated changes in cell cycle progression and apoptosis, perhaps by a decrease in the levels of COX activity
12396617 Heme oxygenase 1 mediates the immunomodulatory and antiapoptotic effects of interleukin 13 gene therapy in vivo in rats and in vitro in human cells.
12379283 induction of HO-1 gene mediates protection against oxidants and increases cell survival by a mechanism independent of telomerase enzyme activity
12377749 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12377749 Length polymorphism in the HO-1 gene promoter is related to coronary artery disease susceptibility in Japanese people who also have coronary risk factors such as hypercholesterolemia, diabetes, and smoking.
12376366 results indicate that prolonged overexpression of HO-1 ultimately decreases soluble guanylate cyclase activity by limiting the availability of cellular heme
12376363 TGF-beta1 is a potent inducer of HO-1; the signaling pathway by which TGF-beta1 regulates HO-1 expression in human lung epithelial cells
12376298 Abnormal reduction in endogenous heme oxygenase on the surface of placental trophoblasts may be one of the important mechanisms for the onset of intrauterine growth retardation.
12222997 Observational study of gene-disease association. (HuGE Navigator)
12207883 HO-1 regulates the cell cycle in vascular endothelial and smooth muscle cells
12182912 Observational study of gene-disease association. (HuGE Navigator)
12182912 Patients with AAA were less frequently carriers of short repeats in the HO-1 gene promoter than patients with atherosclerosis or healthy subjects. Short alleles facilitating upregulation of HO-1 may be a protective anti-inflammatory factor against AAA.
12153964 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12151344 expression in colon carcinoma cells exposed to pyrrolidine dithiocarbamate
12136229 Observational study of gene-disease association. (HuGE Navigator)
12136229 microsatellite polymorphism in promoter of heme oxygenase-1 gene is associated with susceptibility to coronary artery disease in type 2 diabetic patients
12133007 transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line
12130498 Exposure of endothelium to sublethal concentrations of heme-oxidized LDL leads to induction of both HO-1 and ferritin, leading to cytotoxicity.
12118938 hHO-1 is potentially able to reduce the risk factors of atherosclerosis, partially due to its cellular protection against oxidative injury and to its inhibitory effect on cellular proliferation
12117910 Rickettsia rickettsii infection of culture human endothelial cells induces heme oxygenase 1 expression
12099373 protection of grafts by this enzyme and its toxic product carbon monoxide
12091240 This enzyme performs the seemingly lackluster function of catabolizing heme to generate bilirubin, carbon monoxide, and free iron.
12086318 Heme oxygenase-1, a protective gene that prevents the rejection of transplanted organs.
11829463 Has a significant role in endothelial cell cycle progression
11820797 Induction of HO-1 mRNA and protein expression in cultured endothelial cells by the active pentaerythrityl tetranitrate metabolite pentaerythrityl trinitrate is followed by increased cellular resistance to oxidant injury.
11786534 Gene transfection of H25A mutant heme oxygenase-1 protects cells against hydroperoxide-induced cytotoxicity
11727267 Expression and regulation in healthy lung and interstitial lung disorders
11718398 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE      1 - 70
SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGD     71 - 140
LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN    141 - 210
IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVAT    211 - 280
VAVGLYAM                                                                  281 - 288
//

Text Mined References (831)

PMID Year Title
27058954 2016 Amyloid Beta-Mediated Hypomethylation of Heme Oxygenase 1 Correlates with Cognitive Impairment in Alzheimer's Disease.
27023064 2016 Role of Nrf2, HO-1 and GSH in Neuroblastoma Cell Resistance to Bortezomib.
26898422 2016 Heme oxygenase-1 contributes to imatinib resistance by promoting autophagy in chronic myeloid leukemia through disrupting the mTOR signaling pathway.
26822586 2016 Blocking heme oxygenase-1 by zinc protoporphyrin reduces tumor hypoxia-mediated VEGF release and inhibits tumor angiogenesis as a potential therapeutic agent against colorectal cancer.
26782424 2015 Role of heme oxygenase-1 in demethylating effects on SKM-1 cells induced by decitabine.
26777482 2016 Beneficial effects of the transgenic expression of human sTNF-?R-Fc and HO-1 on pig-to-mouse islet xenograft survival.
26726846 2016 Haem oxygenase 1 expression is associated with prognosis in cholangiocarcinoma patients and with drug sensitivity in xenografted mice.
26700310 2016 Potential crosstalk of the interleukin-6-heme oxygenase-1-dependent mechanism involved in resistance to lenalidomide in multiple myeloma cells.
26697129 2016 The Nrf2/HO-1 Axis in Cancer Cell Growth and Chemoresistance.
26690352 2015 Heme Oxygenase-1 Inhibits HLA Class I Antibody-Dependent Endothelial Cell Activation.
26680374 2016 Hemin Preconditioning Upregulates Heme Oxygenase-1 in Deceased Donor Renal Transplant Recipients: A Randomized, Controlled, Phase IIB Trial.
26672618 2016 Proximal tubule-targeted heme oxygenase-1 in cisplatin-induced acute kidney injury.
26652036 2016 Comparison of the Mechanisms of Heme Hydroxylation by Heme Oxygenases-1 and -2: Kinetic and Cryoreduction Studies.
26600472 2015 Determination of Heavy Metal Concentrations in Normal and Pathological Human Endometrial Biopsies and In Vitro Regulation of Gene Expression by Metals in the Ishikawa and Hec-1b Endometrial Cell Line.
26595750 2016 Targeting of heme oxygenase-1 as a novel immune regulator of neuroblastoma.
26576971 2015 Ultrasound up-regulates expression of heme oxygenase-1 gene in endothelial cells.
26566708 2016 Effect of heme oxygenase-1 gene promoter polymorphism on cancer risk by histological subtype: A prospective study in arseniasis-endemic areas in Taiwan.
26555743 2016 PLASMA HEME OXYGENASE-1 IN PATIENTS RESUSCITATED FROM OUT-OF-HOSPITAL CARDIAC ARREST.
26534961 2016 Time-resolved Studies of IsdG Protein Identify Molecular Signposts along the Non-canonical Heme Oxygenase Pathway.
26512585 2015 Association Between Heme Oxygenase-1 Promoter Polymorphisms and the Development of Albuminuria in Type 2 Diabetes: A Case-Control Study.
26507778 2016 Aged garlic extract enhances heme oxygenase-1 and glutamate-cysteine ligase modifier subunit expression via the nuclear factor erythroid 2-related factor 2-antioxidant response element signaling pathway in human endothelial cells.
26483091 2016 Association of HO-1 (GT)n Promoter Polymorphism and Cardiovascular Disease: A Reanalysis of the Literature.
26456668 2015 Alleviation of apoptosis of bone marrow-derived mesenchymal stem cells in the acute injured kidney by heme oxygenase-1 gene modification.
26445536 2015 Gold nanoparticles induce heme oxygenase-1 expression through Nrf2 activation and Bach1 export in human vascular endothelial cells.
26418896 2015 Heme oxygenase-1 in macrophages controls prostate cancer progression.
26416069 Association of heme oxygenase-1 polymorphisms with cancer risk: A systematic review and meta-analysis.
26405158 2015 Heme oxygenase-1 accelerates erastin-induced ferroptotic cell death.
26385579 2015 Nrf2-driven CD36 and HO-1 gene expression in circulating monocytes correlates with favourable clinical outcome in pregnancy-associated malaria.
26385185 2015 Induction of HO-1 by carbon monoxide releasing molecule-2 attenuates thrombin-induced COX-2 expression and hypertrophy in primary human cardiomyocytes.
26350099 2015 Down-regulation of lipocalin 2 suppresses the growth of human lung adenocarcinoma through oxidative stress involving Nrf2/HO-1 signaling.
26337933 2015 Leukocyte expression of heme oxygenase-1 [hmox1] varies inversely with severity of tricuspid regurgitation in acute pulmonary embolism.
26315932 2015 Impairment of neutrophil oxidative burst in children with sickle cell disease is associated with heme oxygenase-1.
26313808 2015 Heme Oxygenase-1 and 2 Common Genetic Variants and Risk for Restless Legs Syndrome.
26303499 2015 Heme Oxygenase-1 Influences Apoptosis via CO-mediated Inhibition of K+ Channels.
26291278 2015 Coordinated regulation of Nrf2 and histone H3 serine 10 phosphorylation in arsenite-activated transcription of the human heme oxygenase-1 gene.
26283888 2015 Arsenic Trioxide Activate Transcription of Heme Oxygenase-1 by Promoting Nuclear Translocation of NFE2L2.
26277392 2015 Nitration of indoxyl sulfate facilitates its cytotoxicity in human renal proximal tubular cells via expression of heme oxygenase-1.
26270345 2015 How Heme Oxygenase-1 Prevents Heme-Induced Cell Death.
26269184 2015 Induction of Heme Oxygenase-1 Deficiency and Associated Glutamate-Mediated Neurotoxicity Is a Highly Conserved HIV Phenotype of Chronic Macrophage Infection That Is Resistant to Antiretroviral Therapy.
26244607 2015 Dual regulation of skin sensitizer-induced HMOX1 expression by Bach1 and Nrf2: Comparison to regulation of the AKR1C2-ARE element in the KeratinoSens cell line.
26238954 2015 A Preliminary Study on Racial Differences in HMOX1, NFE2L2, and TGF?1 Gene Polymorphisms and Radiation-Induced Late Normal Tissue Toxicity.
26227317 2015 Association of HO-1 and BRCA1 Is Critical for the Maintenance of Cellular Homeostasis in Prostate Cancer.
26218201 2015 Heme oxygenase-1 plays a crucial role in chemoresistance in acute myeloid leukemia.
26186946 2015 The HO-1/CO system regulates mitochondrial-capillary density relationships in human skeletal muscle.
26173399 2015 Heme oxygenase-1 promoter polymorphisms and risk of spina bifida.
26143632 2015 Induction of heme-oxygenase-1 (HO-1) does not enhance adiponectin production in human adipocytes: Evidence against a direct HO-1 - Adiponectin axis.
26142705 2015 Heme oxygenase-1: for better, for worse, in sickness and in health.
26125799 2015 Proapoptotic effects of heme oxygenase-1 inhibitor on Kasumi-1 cells via the ATF4/CHOP/Ire-1? pathway.
26091465 2015 Heme Oxygenase 1 and 2 Common Genetic Variants and Risk for Essential Tremor.
26087182 2015 Heme oxygenase-1 promotes tumor progression and metastasis of colorectal carcinoma cells by inhibiting antitumor immunity.
26041409 2015 Src/STAT3-dependent heme oxygenase-1 induction mediates chemoresistance of breast cancer cells to doxorubicin by promoting autophagy.
26011642 2015 ATF4-dependent induction of heme oxygenase 1 prevents anoikis and promotes metastasis.
26011640 2015 Microglia regulate blood clearance in subarachnoid hemorrhage by heme oxygenase-1.
25962859 2015 Nelumbo nucifera leaves protect hydrogen peroxide-induced hepatic damage via antioxidant enzymes and HO-1/Nrf2 activation.
25956277 2015 Association between GT-repeat polymorphism at heme oxygenase-1 gene promoter and gastric cancer and metastasis.
25933176 2015 Association of HMOX1 and NQO1 Polymorphisms with Metabolic Syndrome Components.
25921464 2015 c-Src-dependent transactivation of EGFR mediates CORM-2-induced HO-1 expression in human tracheal smooth muscle cells.
25891083 2015 Curcumin inhibits appoptosin-induced apoptosis via upregulating heme oxygenase-1 expression in SH-SY5Y cells.
25888733 2015 Polymorphisms in the Haem Oxygenase-1 promoter are not associated with severity of Plasmodium falciparum malaria in Ghanaian children.
25883219 2015 PKC?-CREB-Nrf2 signalling induces HO-1 in the vascular endothelium and enhances resistance to inflammation and apoptosis.
25864768 The heme oxygenase/biliverdin reductase system in skin cancers.
25835554 2015 Heme oxygenase-1 gene promoter polymorphism and the risk of pediatric nonalcoholic fatty liver disease.
25828744 2015 Heme oxygenase-1 suppresses the apoptosis of acute myeloid leukemia cells via the JNK/c-JUN signaling pathway.
25822459 2015 The Number of GT(n) Repeats in the Hemeoxygenase-1 Gene Promoter is Increased in Pediatric Heart Failure but is Unrelated to Renal, Antioxidant and Anti-inflammatory Markers.
25820186 2015 Heme oxygenase-1 modulates microRNA expression in cultured astroglia: implications for chronic brain disorders.
25802333 2015 Induction of heme oxygenase-1 by Na+-H+ exchanger 1 protein plays a crucial role in imatinib-resistant chronic myeloid leukemia cells.
25776458 2015 Myrosinase-treated glucoerucin is a potent inducer of the Nrf2 target gene heme oxygenase 1--studies in cultured HT-29 cells and mice.
25772769 2015 Autophagy is upregulated in ovarian endometriosis: a possible interplay with p53 and heme oxygenase-1.
25751573 2015 Genetic polymorphisms of heme-oxygenase 1 (HO-1) may impact on acute kidney injury, bronchopulmonary dysplasia, and mortality in premature infants.
25677507 Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway.
25661467 2015 High glucose promotes tumor invasion and increases metastasis-associated protein expression in human lung epithelial cells by upregulating heme oxygenase-1 via reactive oxygen species or the TGF-?1/PI3K/Akt signaling pathway.
25656973 2015 The Stress-responsive Heme Oxygenase (HO)-1 Isoenzyme is Increased in Labouring Myometrium where it Regulates Contraction-associated Proteins.
25652861 2015 [Mycoplasma genitalium-derived lipid-associated membrane proteins negatively regulate cytokine secretion by inducing HO-1 expression in placental trophoblast cells].
25645920 2015 Novel roles of c-Met in the survival of renal cancer cells through the regulation of HO-1 and PD-L1 expression.
25638774 2015 Induction of heme oxygenase-1 contributes to survival of Mycobacterium abscessus in human macrophages-like THP-1 cells.
25620054 2015 Heme oxygenase-1 protects endothelial cells from the toxicity of air pollutant chemicals.
25615876 2015 Pretreatment with pPolyHb attenuates H2O2-induced endothelial cell injury through inhibition of JNK/p38 MAPK pathway by upregulation of heme oxygenase-1.
25612606 2015 Heme oxygenase-1 restores impaired GARPCD4?CD25? regulatory T cells from patients with acute coronary syndrome by upregulating LAP and GARP expression on activated T lymphocytes.
25608140 2015 Transforming growth factor-?1 protects against intestinal epithelial barrier dysfunction caused by hypoxia-reoxygenation.
25585641 2015 Silencing HO-1 sensitizes SKM-1 cells to apoptosis induced by low concentration 5-azacytidine through enhancing p16 demethylation.
25582460 2015 Haptoglobin attenuates hemoglobin-induced heme oxygenase-1 in renal proximal tubule cells and kidneys of a mouse model of sickle cell disease.
25574604 2015 No association between HMOX1 and risk of colorectal cancer and no interaction with diet and lifestyle factors in a prospective Danish case-cohort study.
25530680 2014 Myeloperoxidase oxidized LDL interferes with endothelial cell motility through miR-22 and heme oxygenase 1 induction: possible involvement in reendothelialization of vascular injuries.
25501830 2014 Heme oxygenase-1 protects against Alzheimer's amyloid-?(1-42)-induced toxicity via carbon monoxide production.
25486479 2014 A knockdown with smoke model reveals FHIT as a repressor of Heme oxygenase 1.
25475440 2015 Unconjugated bilirubin mediates heme oxygenase-1-induced vascular benefits in diabetic mice.
25450361 2014 Non-coding RNAs and heme oxygenase-1 in vaccinia virus infection.
25447985 2015 Regulation of microglial migration, phagocytosis, and neurite outgrowth by HO-1/CO signaling.
25431258 2015 Glucose-regulated protein 78 (GRP78) regulates colon cancer metastasis through EMT biomarkers and the NRF-2/HO-1 pathway.
25428780 2015 Protective role of hemeoxygenase-1 in gastrointestinal diseases.
25404134 2014 Non-coding RNA derived from the region adjacent to the human HO-1 E2 enhancer selectively regulates HO-1 gene induction by modulating Pol II binding.
25377948 2016 The involvement of the Toll-like receptor signaling and Nrf2-Keap1 pathways in the in vitro regulation of IL-8 and HMOX1 for skin sensitization.
25359861 2015 Heme oxygenase-1 gene promoter microsatellite polymorphism is associated with progressive atherosclerosis and incident cardiovascular disease.
25280089 2014 Prognostic value of intrathecal heme oxygenase-1 concentration in patients with Fisher Grade III aneurysmal subarachnoid hemorrhage.
25277974 2014 Heme oxygenase-1 promoter polymorphisms and neonatal jaundice.
25268359 2014 Microsatellite polymorphism in the heme oxygenase-1 gene promoter and the risk of atrial fibrillation in Taiwanese.
25262966 2015 Expression of haem oxygenase-1 correlates with tumour aggressiveness and BRAF V600E expression in thyroid cancer.
25262300 2014 Quantitative trait analysis of polymorphisms in two bilirubin metabolism enzymes to physiologic bilirubin levels in Chinese newborns.
25241054 2014 Heme oxygenase-1 and anti-inflammatory M2 macrophages.
25239913 2014 Impaired TLR4 and HIF expression in cystic fibrosis bronchial epithelial cells downregulates hemeoxygenase-1 and alters iron homeostasis in vitro.
25236576 2014 Heme oxygenase-1 has antitumoral effects in colorectal cancer: involvement of p53.
25231232 2014 Potential crosstalk of Ca2+-ROS-dependent mechanism involved in apoptosis of Kasumi-1 cells mediated by heme oxygenase-1 small interfering RNA.
25218961 2014 Neural HO-1/sterol interactions in vivo: implications for Alzheimer's disease.
25207998 UVA irradiation induced heme oxygenase-1: a novel phototherapy for morphea.
25202977 2014 Heme oxygenase-1 deficiency accompanies neuropathogenesis of HIV-associated neurocognitive disorders.
25201427 2014 Association of heme oxygenase-1 gene promoter polymorphism and blood pressure in an Iranian population.
25199502 2014 Comparison of the molecular topologies of stress-activated transcription factors HSF1, AP-1, NRF2, and NF-?B in their induction kinetics of HMOX1.
25196646 2015 Modulation of heme oxygenase-1 by metalloporphyrins increases anti-viral T cell responses.
25187885 2014 HMOX1 gene promoter polymorphism is not associated with coronary artery disease in Koreans.
25162226 2014 Induction of peroxiredoxin 1 by hypoxia regulates heme oxygenase-1 via NF-?B in oral cancer.
25150395 2014 Up-regulation of heme oxygenase-1 expression modulates reactive oxygen species level during the cryopreservation of human seminiferous tubules.
25122478 2014 Epidermal growth factor stimulates nuclear factor-?B activation and heme oxygenase-1 expression via c-Src, NADPH oxidase, PI3K, and Akt in human colon cancer cells.
25110805 2014 Increased serum heme oxygenase-1 levels as a diagnostic marker of oxidative stress in preeclampsia.
25109682 2015 Monosodium urate crystals trigger Nrf2- and heme oxygenase-1-dependent inflammation in THP-1 cells.
25069505 2014 Induction of heme oxygenase-1 attenuates lipopolysaccharide-induced inflammasome activation in human gingival epithelial cells.
25063314 2014 Heme oxygenase-1 expression is associated with tumor aggressiveness and outcomes in patients with bladder cancer: a correlation with smoking intensity.
25036905 2014 Heme oxygenase-1 gene promoter polymorphism is associated with the development of necrotizing acute pancreatitis.
25023856 2014 Tyrosine oxidation in heme oxygenase: examination of long-range proton-coupled electron transfer.
25016572 2014 Association of heme oxygenase-1 gene rs2071746 polymorphism with vascular outcomes in patients with atherosclerotic stroke.
24995976 2014 Heme oxygenase-1 drives metaflammation and insulin resistance in mouse and man.
24969894 2014 Association between the (GT)n polymorphism of the HO-1 gene promoter region and cancer risk: a meta-analysis.
24957789 2014 Prognostic significance of heme oxygenase-1, S100 calcium-binding protein A4, and syndecan-1 expression in primary non-muscle-invasive bladder cancer.
24931165 2015 Signal peptide peptidase-mediated nuclear localization of heme oxygenase-1 promotes cancer cell proliferation and invasion independent of its enzymatic activity.
24819505 2014 Regulation and novel action of thymidine phosphorylase in non-small cell lung cancer: crosstalk with Nrf2 and HO-1.
24813593 Heme oxygenase-1 overexpression exacerbates heart failure with aging and pressure overload but is protective against isoproterenol-induced cardiomyopathy in mice.
24801208 2014 Matrix conditions and KLF2-dependent induction of heme oxygenase-1 modulate inhibition of HCV replication by fluvastatin.
24799610 2014 Microsatellite polymorphism in the heme oxygenase-1 promoter is associated with nonsevere and late-onset preeclampsia.
24786516 2014 MicroRNA miR-320a modulates induction of HO-1, GCLM and OKL38 by oxidized phospholipids in endothelial cells.
24762402 2014 Length polymorphism in heme oxygenase-1 and risk of CKD among patients with coronary artery disease.
24752012 2014 Hepatic HMOX1 expression positively correlates with Bach-1 and miR-122 in patients with HCV mono and HIV/HCV coinfection.
24733848 2014 Bromodomain and extraterminal proteins suppress NF-E2-related factor 2-mediated antioxidant gene expression.
24694788 2014 Protective effect of adenoviral transfer of heme oxygenase-1 gene on rats with severe acute pancreatitis.
24690955 2014 Serum bilirubin affects graft outcomes through UDP-glucuronosyltransferase sequence variation in kidney transplantation.
24670375 2014 Association between heme oxygenase 1 gene promoter polymorphisms and susceptibility to coronary artery disease: a HuGE review and meta-analysis.
24655000 2014 The expression, function and targeting of haem oxygenase-1 in cancer.
24636201 2014 Expression of methionine adenosyltransferase 2A in renal cell carcinomas and potential mechanism for kidney carcinogenesis.
24616552 2014 HO-1 induction by CO-RM2 attenuates TNF-?-induced cytosolic phospholipase A2 expression via inhibition of PKC?-dependent NADPH oxidase/ROS and NF-?B.
24613679 2014 Hemopexin-dependent heme uptake via endocytosis regulates the Bach1 transcription repressor and heme oxygenase gene activation.
24612419 2014 Enhanced expression of hemoglobin scavenger receptor and heme oxygenase-1 is associated with aortic valve stenosis in patients undergoing hemodialysis.
24607880 2014 Inducible nitric oxide synthase and heme oxygenase 1 are expressed in human cumulus cells and may be used as biomarkers of oocyte competence.
24585089 2014 Association of heme oxygenase-1 with the risk of polycystic ovary syndrome in non-obese women.
24568186 2014 15-deoxy-?12,14-prostaglandin J? induces p53 expression through Nrf2-mediated upregulation of heme oxygenase-1 in human breast cancer cells.
24553299 2014 Heme oxygenase-1 promotes migration and ?-epithelial Na+ channel expression in cytotrophoblasts and ischemic placentas.
24512908 2014 CO-releasing molecules and increased heme oxygenase-1 induce protein S-glutathionylation to modulate NF-?B activity in endothelial cells.
24500083 2014 PECAM-1-dependent heme oxygenase-1 regulation via an Nrf2-mediated pathway in endothelial cells.
24497084 2014 Production and characterization of soluble human TNFRI-Fc and human HO-1(HMOX1) transgenic pigs by using the F2A peptide.
24485305 2013 Stress perception and (GT)n repeat polymorphism in haem oxygenase 1 promoter are both risk factors in development of eating disorders.
24456890 2014 Nrf-2-HO-1-HMGB1 axis: an important therapeutic approach for protection against myocardial ischemia and reperfusion injury.
24440642 2014 Astroglial heme oxygenase-1 and the origin of corpora amylacea in aging and degenerating neural tissues.
24413553 2014 Brain tumors enhance plasmatic coagulation: the role of hemeoxygenase-1.
24366007 2014 Nutlin-3 induces HO-1 expression by activating JNK in a transcription-independent manner of p53.
24320035 2014 The role of the heme oxygenase system in the metabolic syndrome.
24300974 2014 Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-?B and MAPK/HO-1 signalling.
24239896 2014 Heme oxygenase-1 counteracts contrast media-induced endothelial cell dysfunction.
24234335 2014 Heme oxygenase-1 expression in human gliomas and its correlation with poor prognosis in patients with astrocytoma.
24226420 2014 Critical role of 5-lipoxygenase and heme oxygenase-1 in wound healing.
24211270 2014 The induction of heme oxygenase-1 suppresses heat shock protein 90 and the proliferation of human breast cancer cells through its byproduct carbon monoxide.
24201221 2013 Short (GT)n microsatellite repeats in the heme oxygenase-1 gene promoter are associated with antioxidant and anti-inflammatory status in Mexican pediatric patients with sepsis.
24200599 2014 Oncogenic potential of Nrf2 and its principal target protein heme oxygenase-1.
24180625 2013 Expression of nerve growth factor and heme oxygenase-1 predict poor survival of breast carcinoma patients.
24180608 2014 Heme oxygenase-1 as a target for drug discovery.
24180287 2014 New insights into intracellular locations and functions of heme oxygenase-1.
24180257 2014 Heme oxygenase-1: a metabolic nike.
24147608 2014 The mononuclear phagocyte system in homeostasis and disease: a role for heme oxygenase-1.
24140555 2014 Haeme oxygenase activity protects the host against excessive cardiac inflammation during experimental Trypanosoma cruzi infection.
24131232 2014 The multifunctional role and therapeutic potential of HO-1 in the vascular endothelium.
24117426 2014 Andrographolide exerts anti-hepatitis C virus activity by up-regulating haeme oxygenase-1 via the p38 MAPK/Nrf2 pathway in human hepatoma cells.
24109237 2013 The cytoprotective enzyme heme oxygenase-1 suppresses Ebola virus replication.
24098580 2013 Alternative 5' untranslated regions are involved in expression regulation of human heme oxygenase-1.
24075775 2013 Docosahexaenoic acid (DHA)-induced heme oxygenase-1 attenuates cytotoxic effects of DHA in vascular smooth muscle cells.
24053682 2014 Role of heme oxygenase-1 in postnatal differentiation of stem cells: a possible cross-talk with microRNAs.
24053646 2013 3-aroylmethylene-2,3,6,7-tetrahydro-1H-pyrazino[2,1-a]isoquinolin-4(11bH)-ones as potent Nrf2/ARE inducers in human cancer cells and AOM-DSS treated mice.
24038461 2013 Effects of heme oxygenase-1 on bacterial antigen-induced articular chondrocyte catabolism in vitro.
23981612 2013 Heme oxygenase-1 promotes Caco-2 cell proliferation and migration by targeting CTNND1.
23939757 2013 The balance mediated by miRNAs and the heme oxygenase 1 feedback loop contributes to biological effects.
23925400 2015 VEGFR-1, Bcl-2, and HO-1 Ratios in Pregnant Women With Hypertension.
23919806 2013 Upregulation of Ying Yang 1 (YY1) suppresses esophageal squamous cell carcinoma development through heme oxygenase-1.
23893806 2013 Human mesenchymal stem cells elevate CD4+CD25+CD127low/- regulatory T cells of asthmatic patients via heme oxygenase-1.
23877636 2013 Heme oxygenase-1 gene variants and hyperbilirubinemia risk in North Indian newborns.
23840483 2013 Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes.
23813560 2013 Length polymorphism in heme oxygenase-1 and cardiovascular events and mortality in hemodialysis patients.
23792437 2013 Dysregulated heme oxygenase-ferritin system in pterygium pathogenesis.
23739547 2013 Tertiary-butylhydroquinone upregulates expression of ATP-binding cassette transporter A1 via nuclear factor E2-related factor 2/heme oxygenase-1 signaling in THP-1 macrophage-derived foam cells.
23737527 2013 Transforming growth factor-? induces transcription factors MafK and Bach1 to suppress expression of the heme oxygenase-1 gene.
23728734 2014 Microsatellite polymorphism in the heme oxygenase-1 gene promoter is not associated with alcoholic liver disease severity.
23725037 2013 Polymorphism in the HMOX1 gene is associated with high levels of fetal hemoglobin in Brazilian patients with sickle cell anemia.
23720344 2013 Mitochondria-targeted heme oxygenase-1 decreases oxidative stress in renal epithelial cells.
23716558 2013 Development of inhibitory antibodies to therapeutic factor VIII in severe hemophilia A is associated with microsatellite polymorphisms in the HMOX1 promoter.
23714423 2013 Heme oxygenase-1 expression in peripheral blood mononuclear cells correlates with disease activity in multiple sclerosis.
23671274 2013 Carbon monoxide inhibition of Cav3.2 T-type Ca2+ channels reveals tonic modulation by thioredoxin.
23665328 2013 Heme oxygenase-1 induction alters chemokine regulation and ameliorates human immunodeficiency virus-type-1 infection in lipopolysaccharide-stimulated macrophages.
23660665 2013 Identification of two genes potentially associated in iron-heme homeostasis in human carotid plaque using microarray analysis.
23617628 2013 Interplay between heme oxygenase-1 and miR-378 affects non-small cell lung carcinoma growth, vascularization, and metastasis.
23615401 2013 Induction of heme oxygenase-1 and inhibition of TPA-induced matrix metalloproteinase-9 expression by andrographolide in MCF-7 human breast cancer cells.
23606537 2013 Reduced caveolin-1 promotes hyperinflammation due to abnormal heme oxygenase-1 localization in lipopolysaccharide-challenged macrophages with dysfunctional cystic fibrosis transmembrane conductance regulator.
23602216 2013 Shorter GT repeats in the heme oxygenase-1 gene promoter are associated with a lower severity score in coronary artery disease.
23583371 2013 Silencing heme oxygenase-1 gene expression in retinal pigment epithelial cells inhibits proliferation, migration and tube formation of cocultured endothelial cells.
23580430 2013 Upregulation of Nrf2 expression by human cytomegalovirus infection protects host cells from oxidative stress.
23571756 2013 Nrf2 activation is associated with Z-DNA formation in the human HO-1 promoter.
23569422 2013 Propofol-induced protection of SH-SY5Y cells against hydrogen peroxide is associated with the HO-1 via the ERK pathway.
23567851 2013 Homocysteine induces heme oxygenase-1 expression via transcription factor Nrf2 activation in HepG2 cell.
23536693 2013 Mycoplasma fermentans MALP-2 induces heme oxygenase-1 expression via mitogen-activated protein kinases and Nrf2 pathways to modulate cyclooxygenase 2 expression in human monocytes.
23526997 2013 Preoperative HO-1 levels as prognostic factor for adverse cardiac events in elder patients undergoing non-cardiac surgery.
23521418 2013 HO-1 as modulator of the innate immune response in pregnancy.
23454680 2013 Role of ?-synuclein aggregation and the nuclear factor E2-related factor 2/heme oxygenase-1 pathway in iron-induced neurotoxicity.
23437133 2013 The association between heme oxygenase-1 gene promoter polymorphism and the outcomes of catheter ablation of atrial fibrillation.
23430116 2013 GT microsatellite repeats in the heme oxygenase-1 gene promoter associated with abdominal aortic aneurysm in Croatian patients.
23423194 2013 Role of heme oxygenase 1 in TNF/TNF receptor-mediated apoptosis after hepatic ischemia/reperfusion in rats.
23412940 2013 Upregulation of HO-1 is accompanied by activation of p38MAPK and mTOR in human oesophageal squamous carcinoma cells.
23406650 Heme oxygenase-1 promoter polymorphisms do not influence susceptibility to systemic sclerosis and its clinical phenotypes.
23406266 2013 Haem oxygenase-1 induction reverses the actions of interleukin-1? on hypoxia-inducible transcription factors and human chondrocyte metabolism in hypoxia.
23403272 2013 Paeoniflorin protects human EA.hy926 endothelial cells against gamma-radiation induced oxidative injury by activating the NF-E2-related factor 2/heme oxygenase-1 pathway.
23403148 2013 Heme oxygenase-1 in placental development and pathology.
23392716 2013 Over-expression of heme oxygenase-1 does not protect porcine endothelial cells from human xenoantibodies and complement-mediated lysis.
23347118 2013 Inhibition of fatty acid amide hydrolase activates Nrf2 signalling and induces heme oxygenase 1 transcription in breast cancer cells.
23345623 2013 Length polymorphisms of heme oxygenase-1 determine the effect of far-infrared therapy on the function of arteriovenous fistula in hemodialysis patients: a novel physicogenomic study.
23324179 2013 AMP-activated protein kinase inhibits TGF-?-, angiotensin II-, aldosterone-, high glucose-, and albumin-induced epithelial-mesenchymal transition.
23293173 2013 The prediction of coronary artery disease based on non-invasive examinations and heme oxygenase 1 polymorphism versus virtual histology.
23288142 2013 Inhibition of matrix metalloproteinase-9 expression by docosahexaenoic acid mediated by heme oxygenase 1 in 12-O-tetradecanoylphorbol-13-acetate-induced MCF-7 human breast cancer cells.
23255485 2013 Dietary flavonoid genistein induces Nrf2 and phase II detoxification gene expression via ERKs and PKC pathways and protects against oxidative stress in Caco-2 cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23238643 2013 Intermittent hypoxia-induced NF-?B and HO-1 regulation in human endothelial EA.hy926 cells.
23226098 2012 Unveiling the association of STAT3 and HO-1 in prostate cancer: role beyond heme degradation.
23221079 2013 Oxidative stress increases HO-1 expression in ARPE-19 cells, but melanosomes suppress the increase when light is the stressor.
23158494 2012 [Role of heme oxygenase-1 in the apoptosis of mesenchymal stem cells].
23150184 2013 Heme oxygenase-1 attenuates epithelial-to-mesenchymal transition of human peritoneal mesothelial cells.
23139759 2012 Maternal serum heme-oxygenase-1 (HO-1) concentrations in early pregnancy and subsequent risk of gestational diabetes mellitus.
23123430 2013 High-density lipoproteins inhibit vascular endothelial inflammation by increasing 3?-hydroxysteroid-?24 reductase expression and inducing heme oxygenase-1.
23114386 2012 Serum heme oxygenase-1 as a marker of lung function decline in patients with chronic silicosis.
23103292 2013 Antibodies against dengue virus nonstructural protein-1 induce heme oxygenase-1 via a redox-dependent pathway in human endothelial cells.
23097500 2013 Structural insights into human heme oxygenase-1 inhibition by potent and selective azole-based compounds.
23092328 2013 Heme Oxygenase-1 and breast cancer resistance protein protect against heme-induced toxicity.
23090292 2013 The influence of exogenous carbohydrate provision and pre-exercise alkalosis on the heat shock protein response to prolonged interval cycling.
23087099 2013 Pre-emptive hypoxia-regulated HO-1 gene therapy improves post-ischaemic limb perfusion and tissue regeneration in mice.
23074199 2012 Osteopontin increases heme oxygenase-1 expression and subsequently induces cell migration and invasion in glioma cells.
23055342 2012 High expression of heme oxygenase-1 is associated with tumor invasiveness and poor clinical outcome in non-small cell lung cancer patients.
23052192 2013 Hard-metal (WC-Co) particles trigger a signaling cascade involving p38 MAPK, HIF-1?, HMOX1, and p53 activation in human PBMC.
23051580 2013 Haem oxygenase-1 inhibits phosphorylation of the Helicobacter pylori oncoprotein CagA in gastric epithelial cells.
23046979 2013 Diallyl tetrasulfane activates both the eIF2? and Nrf2/HO-1 pathways.
23010497 2012 Histone deacetylase 6 (HDAC6) plays a crucial role in p38MAPK-dependent induction of heme oxygenase-1 (HO-1) in response to proteasome inhibition.
22989377 2013 Haem oxygenase-1 overexpression alters intracellular iron distribution.
22966170 2012 Heme oxygenase-1 gene promoter polymorphism is associated with reduced incidence of acute chest syndrome among children with sickle cell disease.
22959128 2012 Increased risk of venous thromboembolism is associated with genetic variation in heme oxygenase-1 in Blacks.
22945906 2013 Peroxisome proliferator-activated receptor delta agonist attenuates nicotine suppression effect on human mesenchymal stem cell-derived osteogenesis and involves increased expression of heme oxygenase-1.
22939811 2012 Reduced heme oxygenase-1 expression in steatotic livers infected with hepatitis C virus.
22901690 2013 Docosahexaenoic acid inhibition of inflammation is partially via cross-talk between Nrf2/heme oxygenase 1 and IKK/NF-?B pathways.
22881289 2012 Unregulated brain iron deposition in transgenic mice over-expressing HMOX1 in the astrocytic compartment.
22879597 2012 The heme oxygenase 1 inducer (CoPP) protects human cardiac stem cells against apoptosis through activation of the extracellular signal-regulated kinase (ERK)/NRF2 signaling pathway and cytokine release.
22875919 2012 Schizophrenia-like features in transgenic mice overexpressing human HO-1 in the astrocytic compartment.
22849380 2013 Combined platelet count with sCD163 and genetic variants optimizes esophageal varices prediction in cirrhotic patients.
22843690 2012 Heme oxygenase-1 promotes survival of renal cancer cells through modulation of apoptosis- and autophagy-regulating molecules.
22842631 2012 Globular adiponectin inhibits ethanol-induced apoptosis in HepG2 cells through heme oxygenase-1 induction.
22776971 2012 HO-1/BVR-a system analysis in plasma from probable Alzheimer's disease and mild cognitive impairment subjects: a potential biochemical marker for the prediction of the disease.
22750196 2012 Heme oxygenase-1 and chronic hypoxia.
22698995 The let-7 microRNA enhances heme oxygenase-1 by suppressing Bach1 and attenuates oxidant injury in human hepatocytes.
22689053 2013 TRC8 suppresses tumorigenesis through targeting heme oxygenase-1 for ubiquitination and degradation.
22682876 2012 Compensated inflammation in systemic juvenile idiopathic arthritis: role of alternatively activated macrophages.
22670665 2012 Expression of heme oxygenase-1 in response to proteasomal inhibition.
22666428 2012 Genetic analyses of heme oxygenase 1 (HMOX1) in different forms of pancreatitis.
22630328 2012 Urinary heme oxygenase-1 in children with congenital hydronephrosis due to ureteropelvic junction obstruction.
22613607 2012 Activity of heme oxygenase-1 affects expression levels of hypoxia inducible factor-1 gene in vitro.
22609818 2013 Genetic polymorphisms of HO-1 and COX-1 are associated with aspirin resistance defined by light transmittance aggregation in Chinese Han patients.
22594519 2012 A deficiency in haem oxygenase-1 induces foetal growth restriction by placental vasculature defects.
22587389 2012 Haem oxygenase 1 expression is altered in monocytes from patients with systemic lupus erythematosus.
22583702 2012 Heme oxygenase microsatellite polymorphism, oxidative stress, glycemic control, and complication development in type 2 diabetes patients.
22580187 2012 Nuclear localization of heme oxygenase-1 is associated with tumor progression of head and neck squamous cell carcinomas.
22579918 2012 Sustained expression of heme oxygenase-1 alters iron homeostasis in nonerythroid cells.
22578957 2012 Microsatellite polymorphism in haem oxygenase 1 gene promoter in multiple sclerosis.
22578468 2012 HO-1 induction in motor cortex and intestinal dysfunction in TDP-43 A315T transgenic mice.
22573121 2012 Calcitonin gene-related peptide, heme oxygenase-1, endothelial progenitor cells and nitric oxide-dependent vasodilation relationships in a human model of angiotensin II type-1 receptor antagonism.
22559824 2012 Expression of heme oxygenase in the eutopic and ectopic endometrium in patients with adenomyosis.
22549002 2012 Heme oxygenase-1 posttranslational modifications in the brain of subjects with Alzheimer disease and mild cognitive impairment.
22545110 2012 Heme oxygenase isoforms differ in their subcellular trafficking during hypoxia and are differentially modulated by cytochrome P450 reductase.
22542718 2012 Association of hsp70-2 (+1267A/G), hsp70-hom (+2437T/C), HMOX-1 (number of GT repeats) and TNF-alpha (+489G/A) polymorphisms with COPD in Croatian population.
22541814 2012 Thrombin induces heme oxygenase-1 expression in human synovial fibroblasts through protease-activated receptor signaling pathways.
22503972 2012 Stanniocalcin 2, forms a complex with heme oxygenase 1, binds hemin and is a heat shock protein.
22490514 2012 Expression and function of heme oxygenase-1 in human gastric cancer.
22461696 2012 Heme oxygenase-1 promotes the persistence of Leishmania chagasi infection.
22438807 2012 HMOX1 gene promoter alleles and high HO-1 levels are associated with severe malaria in Gambian children.
22427825 2012 Plasma heme oxygenase-1 concentration in relation to impaired glucose regulation in a non-diabetic Chinese population.
22419571 2012 Endoplasmic reticulum anchored heme-oxygenase 1 faces the cytosol.
22418244 2012 Expression of heme oxygenase-1 in non-small cell lung cancer (NSCLC) and its correlation with clinical data.
22338608 HMOX1 promoter (GT)n polymorphim is associated with childhood-onset systemic lupus erythematosus but not with juvenile rheumatoid arthritis in a Mexican population.
22330859 2012 Effects of estrogen on endothelial prostanoid production and cyclooxygenase-2 and heme oxygenase-1 expression.
22323644 2012 Expression of heme oxygenase-1 in thick ascending loop of henle attenuates angiotensin II-dependent hypertension.
22302482 2012 Involvement of heme oxygenase-1 in Korean colon cancer.
22290142 2012 Association between the haptoglobin and heme oxygenase 1 genetic profiles and soluble CD163 in susceptibility to and severity of human malaria.
22276118 2012 A novel, "double-clamp" binding mode for human heme oxygenase-1 inhibition.
22271370 2012 Heme oxygenase-1 promoter polymorphism is associated with risk of malignant mesothelioma.
22264017 2013 Heme oxygenase expression as a biomarker of exposure to amphiphilic polymer-coated CdSe/ZnS quantum dots.
22212955 2012 Association of serum bilirubin and promoter variations in HMOX1 and UGT1A1 genes with sporadic colorectal cancer.
22203790 2011 Quercetin protects primary human osteoblasts exposed to cigarette smoke through activation of the antioxidative enzymes HO-1 and SOD-1.
22200625 2012 Heme oxygenase-1 system, inflammation and ventilator-induced lung injury.
22158875 2012 Interleukin-19 (IL-19) induces heme oxygenase-1 (HO-1) expression and decreases reactive oxygen species in human vascular smooth muscle cells.
22155307 2012 Heme oxygenase-1 mediates protective effects on inflammatory, catabolic and senescence responses induced by interleukin-1? in osteoarthritic osteoblasts.
22147556 2012 The role of inducible nitric oxide synthase and haem oxygenase 1 in growth and development of dental tissue'.
22142473 2012 Resistance of neuroblastoma GI-ME-N cell line to glutathione depletion involves Nrf2 and heme oxygenase-1.
22138245 2012 Heme oxygenase-1 (HO-1) is constitutively up-regulated in top alpinists.
22137262 2012 Epigallocatechin gallate induces expression of heme oxygenase-1 in endothelial cells via p38 MAPK and Nrf-2 that suppresses proinflammatory actions of TNF-?.
22123460 2011 Genetic variants in haem oxygenase-1 and endothelial nitric oxide synthase influence the extent and evolution of coronary artery atherosclerosis.
22099756 2011 Modest effects of Fas-ligand and heme oxygenase-1 double transgenic mouse islets on transplantation outcomes.
22095074 2012 Guggulsterone induces heme oxygenase-1 expression through activation of Nrf2 in human mammary epithelial cells: PTEN as a putative target.
22088544 2011 Genotype and allele frequencies of heme oxygenase-1 promoter region in a Greek cohort.
22078849 2012 Heme oxygenase-1 expression in chronic rhinosinusitis with eosinophilic infiltration.
22048453 2012 Variations in the heme oxygenase-1 microsatellite polymorphism are associated with plasma CD14 and viral load in HIV-infected African-Americans.
21992109 2012 Haem oxygenase-1: non-canonical roles in physiology and pathology.
21987660 2011 Disruption of nitric oxide signaling by Helicobacter pylori results in enhanced inflammation by inhibition of heme oxygenase-1.
21982894 2011 Heme oxygenase 1 is induced by miR-155 via reduced BACH1 translation in endothelial cells.
21945498 2011 Association of heme oxygenase-1 GT-repeat polymorphism with blood pressure phenotypes and its relevance to future cardiovascular mortality risk: an observation based on arsenic-exposed individuals.
21911919 2011 Protection of acute myeloid leukaemia cells from apoptosis induced by front-line chemotherapeutics is mediated by haem oxygenase-1.
21911884 No association of promoter variations of HMOX1 and UGT1A1 genes with liver injury in chronic hepatitis C.
21902835 2011 Effect of heme oxygenase-1 polymorphisms on lung function and gene expression.
21898994 2011 [Expression of heme oxygenase enzyme in the testis tissue and azoospermia].
21889036 2011 Hemeoxygenase-1 expression in response to arecoline-induced oxidative stress in human umbilical vein endothelial cells.
21868703 2011 Heme induces heme oxygenase 1 via Nrf2: role in the homeostatic macrophage response to intraplaque hemorrhage.
21861350 2011 [Effects of inorganic arsenic on mRNA expression of Nrf2 and Nrf2-regulated downstream anti-oxidant enzymes in Chang hepatocytes].
21833623 2011 Heme oxygenase 1 (HO-1) challenges the angiogenic switch in prostate cancer.
21827279 2012 Heme oxygenase-1 inhibits myoblast differentiation by targeting myomirs.
21808062 2011 The heme oxygenase-1 protein is overexpressed in human renal cancer cells following activation of the Ras-Raf-ERK pathway and mediates anti-apoptotic signal.
21781496 2011 [Effects of HO-1 gene expression on proliferation of imatinib resistant CML cells].
21765894 2011 Heme-oxygenases during erythropoiesis in K562 and human bone marrow cells.
21742584 2011 Maesopsin 4-O-beta-D-glucoside, a natural compound isolated from the leaves of Artocarpus tonkinensis, inhibits proliferation and up-regulates HMOX1, SRXN1 and BCAS3 in acute myeloid leukemia.
21741353 2011 Mutations of human cytochrome P450 reductase differentially modulate heme oxygenase-1 activity and oligomerization.
21737788 2011 Network for activation of human endothelial cells by oxidized phospholipids: a critical role of heme oxygenase 1.
21729576 2011 [Expression of radioresistant genes survivin and HO-1 in mesenchymal stem cells].
21725851 2012 Association between heme oxygenase-1 gene promoter polymorphisms and metabolic syndrome in Iranians.
21647550 2012 An association between polymorphism of the heme oxygenase-1 and -2 genes and age-related macular degeneration.
21646819 2011 Heme oxygenase-1 overexpression fails to attenuate hypertension when the nitric oxide synthase system is not fully operative.
21620964 2011 An I?B? phosphorylation inhibitor induces heme oxygenase-1(HO-1) expression through the activation of reactive oxygen species (ROS)-Nrf2-ARE signaling and ROS-PI3K/Akt signaling in an NF-?B-independent mechanism.
21598088 2011 Role of heme oxygenase-1 in inflammatory response induced by mechanical stretch in synovial cells.
21597468 2011 Transformation of eEF1B? into heat-shock response transcription factor by alternative splicing.
21576421 Antepartum and postpartum serum heme oxygenase-1 levels in preeclamptic and normotensive pregnant women.
21556890 2011 Study of GT-repeat expansion in Heme oxygenase-1 gene promoter as genetic cause of male infertility.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21552291 2011 p53 promotes cellular survival in a context-dependent manner by directly inducing the expression of haeme-oxygenase-1.
21545264 2011 Neutrophil gelatinase-associated lipocalin: a new antioxidant that exerts its cytoprotective effect independent on Heme Oxygenase-1.
21531452 2011 Opposing effects of nasal epithelial NAD(P)H dehydrogenase quinine 1 and heme oxygenase 1 expression on upper and lower airway symptoms in adolescents with asthma.
21525764 2010 Protective role of HO-1 for alcohol-dependent liver damage.
21518986 2011 Early macrophage recruitment and alternative activation are critical for the later development of hypoxia-induced pulmonary hypertension.
21506927 2011 Antioxidant effect of a nitrated cyclic nucleotide functioning as an endogenous electrophile.
21502755 2011 Urinary heme oxygenase-1 as a sensitive indicator of tubulointerstitial inflammatory damage in various renal diseases.
21497776 2011 Hsp60 and heme oxygenase-1 (Hsp32) in acute myocardial infarction.
21495030 2011 Heme oxygenase-1 germ line GTn promoter polymorphism is an independent prognosticator of tumor recurrence and survival in pancreatic cancer.
21454555 2011 Heme oxygenase-1 couples activation of mitochondrial biogenesis to anti-inflammatory cytokine expression.
21426408 2011 Heme oxygenase-1 expression protects melanocytes from stress-induced cell death: implications for vitiligo.
21425334 2011 Interaction between heme oxygenase-1 genotypes and exposure to pesticides in Parkinson's disease.
21412259 2011 Heme oxygenase-1 protects human melanocytes from H2O2-induced oxidative stress via the Nrf2-ARE pathway.
21389316 2011 The impact of inflammatory licensing on heme oxygenase-1-mediated induction of regulatory T cells by human mesenchymal stem cells.
21366594 2011 Impairment of oxidative stress-induced heme oxygenase-1 expression by the defect of Parkinson-related gene of PINK1.
21354100 2011 Hypochlorite-modified high-density lipoprotein promotes induction of HO-1 in endothelial cells via activation of p42/44 MAPK and zinc finger transcription factor Egr-1.
21321939 2011 Enterovirus 71 induces integrin ?1/EGFR-Rac1-dependent oxidative stress in SK-N-SH cells: role of HO-1/CO in viral replication.
21307400 2010 FLIP regulation of HO-1 and TNF signalling in human acute myeloid leukemia provides a unique secondary anti-apoptotic mechanism.
21296438 2011 Heme oxygenase 1 regulates the maturation process and inflammatory response in oxLDL-stimulated dendritic cells.
21275653 Association of heme oxygenase-1 gene polymorphisms with essential hypertension and blood pressure in the Chinese Han population.
21269460 2011 Initial characterization of the human central proteome.
21236443 2011 Heme oxygenase-1 promoter polymorphism is a predictor of disease relapse in pancreatic neuroendocrine tumors.
21233593 2011 Evaluation of acute oxidative stress induced by NiO nanoparticles in vivo and in vitro.
21216973 2011 Attenuation of transforming growth factor-?-stimulated collagen production in fibroblasts by quercetin-induced heme oxygenase-1.
21211285 2010 [Effect of lipoxin A(4) on lipopolysaccharide-induced oxidant stress in human umbilical vein endothelial cells].
21206978 2011 Heme oxygenase-1 promotes angiogenesis in urothelial carcinoma of the urinary bladder.
21198350 2011 Association of (GT)n repeats promoter polymorphism of heme oxygenase-1 gene with serum bilirubin levels in healthy Indian adults.
21191307 2011 Heme oxygenase-1 polymorphism is not associated with risk of colorectal cancer: a Danish prospective study.
21174817 2002 [The study on expression of heme oxygenase-1 in the peripheral blood mononuclear cell from asthmatic patients].
21172416 2011 Identification and dissection of the Nrf2 mediated oxidative stress pathway in human renal proximal tubule toxicity.
21157922 2011 The effect of the Gly139His, Gly143His, and Ser142His mouse heme oxygenase-1 mutants on the HO reaction in vivo and in vitro.
21148661 2011 Expression levels of haem oxygenase-1 in the omental adipose tissue and peripheral blood mononuclear cells of women with polycystic ovary syndrome.
21144518 2011 Nrf-2 mediated heme oxygenase-1 expression, an antioxidant-independent mechanism, contributes to anti-atherogenesis and vascular protective effects of Ginkgo biloba extract.
21136273 2011 BMP-6 inhibits MMP-9 expression by regulating heme oxygenase-1 in MCF-7 breast cancer cells.
21113640 2011 Increased level of heme oxygenase-1 in rheumatoid arthritis synovial fluid.
21091076 2011 A central role of heme oxygenase-1 in cardiovascular protection.
21080099 2011 Cross-talk between body iron stores and diabetes: iron stores are associated with activity and microsatellite polymorphism of the heme oxygenase and type 2 diabetes.
21079975 2011 Transepithelial heme-iron transport: effect of heme oxygenase overexpression.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
21037234 2011 Activation of AMPK stimulates heme oxygenase-1 gene expression and human endothelial cell survival.
20938987 2011 Curcumin induces heme oxygenase-1 in normal human skin fibroblasts through redox signaling: relevance for anti-aging intervention.
20934533 2011 Cellular iron depletion weakens induction of heme oxygenase-1 by cadmium.
20869265 2010 Association of genetic polymorphisms and risk of late post-transplantation infection in pediatric heart recipients.
20868356 2010 The protective role of heme oxygenase-1 in cerebral ischemia.
20855888 2010 CXCR3-B can mediate growth-inhibitory signals in human renal cancer cells by down-regulating the expression of heme oxygenase-1.
20846452 2010 Study on association between genetic polymorphisms of haem oxygenase-1, tumour necrosis factor, cadmium exposure and malaria pathogenicity and severity.
20838751 2010 Plasma haemoxygenase-1 in coronary artery disease. A comparison with angiogenin, matrix metalloproteinase-9, tissue inhibitor of metalloproteinase-1 and vascular endothelial growth factor.
20832528 2010 Association between the heme oxygenase-1 promoter polymorphism and renal transplantation outcome in Greece.
20811623 2010 Plasma heme oxygenase-1 concentration is elevated in individuals with type 2 diabetes mellitus.
20796278 2010 GT-repeat polymorphism in the heme oxygenase-1 gene promoter and the risk of carotid atherosclerosis related to arsenic exposure.
20733275 2010 Clinical significance of heme oxygenase-1 expression in non-muscle-invasive bladder cancer.
20708634 2010 GT-repeat polymorphism in the heme oxygenase-1 gene promoter is associated with cardiovascular mortality risk in an arsenic-exposed population in northeastern Taiwan.
20706680 2010 Upregulation of endogenous HMOX1 expression by a computer-designed artificial transcription factor.
20705711 2010 Heme oxygenase-1 inhibits renal tubular macroautophagy in acute kidney injury.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20682519 2010 Association between heme oxygenase-1 gene promoter polymorphisms and type 2 diabetes mellitus: a HuGE review and meta-analysis.
20667089 2010 Transcriptome analysis of human cancer reveals a functional role of heme oxygenase-1 in tumor cell adhesion.
20633528 2010 miR-122-induced down-regulation of HO-1 negatively affects miR-122-mediated suppression of HBV.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20599261 2010 Gene-gene interaction in regulatory T-cell function in atopy and asthma development in childhood.
20597111 2010 Effect of interactions of glutathione S-transferase T1, M1, and P1 and HMOX1 gene promoter polymorphisms with heavy smoking on the risk of rheumatoid arthritis.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20585394 2010 Transforming growth factor beta 2 and heme oxygenase 1 genes are risk factors for the cerebral malaria syndrome in Angolan children.
20580464 Heme Oxygenase-1 expression in M-CSF-polarized M2 macrophages contributes to LPS-induced IL-10 release.
20526373 2010 Induction of heme oxygenase-1, biliverdin reductase and H-ferritin in lung macrophage in smokers with primary spontaneous pneumothorax: role of HIF-1alpha.
20518850 2011 Bile acids decrease intracellular bilirubin levels in the cholestatic liver: implications for bile acid-mediated oxidative stress.
20509889 2010 The polymorphism rs3024505 proximal to IL-10 is associated with risk of ulcerative colitis and Crohns disease in a Danish case-control study.
20508205 2010 Role of heme oxygenase-1 in human endothelial cells: lesson from the promoter allelic variants.
20504881 2010 Parenteral iron formulations differentially affect MCP-1, HO-1, and NGAL gene expression and renal responses to injury.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20482362 2010 The role of heme oxygenase-1 in mechanical stress- and lipopolysaccharide-induced osteogenic differentiation in human periodontal ligament cells.
20446774 2010 Nrf2-Mediated heme oxygenase-1 upregulation as adaptive survival response to glucose deprivation-induced apoptosis in HepG2 cells.
20430037 2010 Conversion of biliverdin to bilirubin by biliverdin reductase contributes to endothelial cell protection by heme oxygenase-1-evidence for direct and indirect antioxidant actions of bilirubin.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20404253 2010 Cardioprotective and antiapoptotic effects of heme oxygenase-1 in the failing heart.
20395442 2010 Heme oxygenase-1 expression in murine dendritic cell subpopulations: effect on CD8+ dendritic cell differentiation in vivo.
20386498 2010 Heme oxygenase 1 polymorphisms and plasma concentrations in critically ill patients.
20351094 2010 Sp1 regulates chromatin looping between an intronic enhancer and distal promoter of the human heme oxygenase-1 gene in renal cells.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20345975 2010 Toluene diisocyanate (TDI) regulates haem oxygenase-1/ferritin expression: implications for toluene diisocyanate-induced asthma.
20345481 2010 Expression of heme oxygenase-1 in human leukemic cells and its regulation by transcriptional repressor Bach1.
20299368 2010 Examination of association with candidate genes for diabetic nephropathy in a Mexican American population.
20232486 2010 Genetic variations in heme oxygenase-1 and chronic hepatitis.
20229611 2010 Erythropoietin induces nuclear translocation of Nrf2 and heme oxygenase-1 expression in SH-SY5Y cells.
20223113 2009 [Heme oxygenase-1 overexpression in patients with malignant obstructive jaundice].
20194081 2010 Traffic-related air pollution and QT interval: modification by diabetes, obesity, and oxidative stress gene polymorphisms in the normative aging study.
20193368 2009 [Effect of alpha-zearalanol upon the expression of HO-1 gene and the cytosolic free calcium level in tumor necrosis factor alpha-stimulated human endothelial cell].
20190330 2010 HMOX1 and GST variants modify attenuation of FEF25-75% decline due to PM10 reduction.
20188821 2010 Cigarette smoke particle-phase extract induces HO-1 expression in human tracheal smooth muscle cells: role of the c-Src/NADPH oxidase/MAPK/Nrf2 signaling pathway.
20175935 2010 Shorter GT repeat polymorphism in the heme oxygenase-1 gene promoter has protective effect on ischemic stroke in dyslipidemia patients.
20170613 2010 [The significance of the changes in expressions of heat shock protein 70 and heme oxygenase-1 in the myocardium in patients died suddenly due to acute myocardial infarction].
20155807 2010 Elevation of heme oxygenase-1 by proteasome inhibition affords dopaminergic neuroprotection.
20127796 2010 MicroRNA-196 represses Bach1 protein and hepatitis C virus gene expression in human hepatoma cells expressing hepatitis C viral proteins.
20121710 2010 Prolonged unconjugated hyperbilirubinaemia associated with the haem oxygenase-1 gene promoter polymorphism.
20110814 2010 Air pollution and homocysteine: more evidence that oxidative stress-related genes modify effects of particulate air pollution.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20064636 2010 Induction of heme oxygenase-1 in normal and malignant B lymphocytes by 15-deoxy-Delta(12,14)-prostaglandin J(2) requires Nrf2.
20055707 2010 Mechanisms of cell protection by heme oxygenase-1.
20049130 2009 Black carbon exposure, oxidative stress genes, and blood pressure in a repeated-measures study.
20039940 2010 Synergistic effect of two oxidative stress-related genes (heme oxygenase-1 and GSK3?) on the risk of Parkinson's disease.
20021945 2009 [Protective effect of HIF-1alpha-dependent HO-1 overexpression on hypoxic human hepatoma cells in vitro].
20020468 2010 Upregulation of heme oxygenase-1 inhibits the maturation and mineralization of osteoblasts.
20013271 2011 Elevated serum heme oxygenase-1 and insulin-like growth factor-1 levels in patients with Henoch-Schonlein purpura.
19965783 2010 Human sickle cell blood modulates endothelial heme oxygenase activity: effects on vascular adhesion and reactivity.
19925812 2010 The mechanism of heme oxygenase-1 action involved in the enhancement of neurotrophic factor expression.
19924377 2010 Overexpression of heme oxygenase-1 increases human osteoblast stem cell differentiation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910578 2010 CXCL4 downregulates the atheroprotective hemoglobin receptor CD163 in human macrophages.
19903769 2009 Critical role of endogenous heme oxygenase 1 as a tuner of the invasive potential of prostate cancer cells.
19903700 2010 PPARdelta and PGC1alpha act cooperatively to induce haem oxygenase-1 and enhance vascular endothelial cell resistance to stress.
19895178 2010 Polymorphism in heme oxygenase-1 (HO-1) promoter and alcohol are related to the risk of esophageal squamous cell carcinoma on Chinese males.
19886851 2009 Association of an intronic variant of the heme oxygenase-1 gene with hypertension in northern Chinese Han population.
19884647 2010 Air pollution, obesity, genes and cellular adhesion molecules.
19879747 2010 Potential immunoregulatory role of heme oxygenase-1 in human milk: a combined biochemical and molecular modeling approach.
19874887 2010 A role for Bach1 and HO-2 in suppression of basal and UVA-induced HO-1 expression in human keratinocytes.
19853072 2010 HO-1 expression increases mesenchymal stem cell-derived osteoblasts but decreases adipocyte lineage.
19850937 2009 Zinc protoporphyrin regulates cyclin D1 expression independent of heme oxygenase inhibition.
19822148 2009 Prolonged cigarette smoke exposure decreases heme oxygenase-1 and alters Nrf2 and Bach1 expression in human macrophages: roles of the MAP kinases ERK(1/2) and JNK.
19808972 2009 A novel experimental heme oxygenase-1-targeted therapy for hormone-refractory prostate cancer.
19808663 2009 Nrf2-dependent and -independent responses to nitro-fatty acids in human endothelial cells: identification of heat shock response as the major pathway activated by nitro-oleic acid.
19797297 2010 Pivotal Advance: Heme oxygenase 1 expression by human CD4+ T cells is not sufficient for their development of immunoregulatory capacity.
19785642 2010 Serum heme oxygenase-1 levels are increased in Parkinson's disease but not in Alzheimer's disease.
19777608 2009 Iron increases HMOX1 and decreases hepatitis C viral expression in HCV-expressing cells.
19696228 2009 Association between heme oxygenase-1 gene promoter polymorphisms and type 2 diabetes in a Chinese population.
19676145 2009 Expression of heme oxygenase-1, hypoxia inducible factor-1alpha, and ubiquitin in peripheral inflammatory cells from patients with coronary heart disease.
19669099 2009 Pharmacokinetics and pharmacodynamics of broccoli sprouts on the suppression of prostate cancer in transgenic adenocarcinoma of mouse prostate (TRAMP) mice: implication of induction of Nrf2, HO-1 and apoptosis and the suppression of Akt-dependent kinase pathway.
19625608 2009 Hypochlorous acid-induced heme oxygenase-1 gene expression promotes human endothelial cell survival.
19604147 2009 Mammalian sterile 20-like kinase 3 (MST3) mediates oxidative-stress-induced cell death by modulating JNK activation.
19590927 2010 Candidate genes associated with susceptibility for SARS-coronavirus.
19587144 2009 GEC-targeted HO-1 expression reduces proteinuria in glomerular immune injury.
19586801 2009 Immunoregulatory effects of HO-1: how does it work?
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19556236 2009 Oligomerization is crucial for the stability and function of heme oxygenase-1 in the endoplasmic reticulum.
19548360 2008 Notopterygium forbesii boiss extract and its active constituents increase reactive species and heme oxygenase-1 in human fetal hepatocytes: mechanisms of action.
19536150 2009 Functional expression of heme oxygenase-1 in human differentiated epidermis and its regulation by cytokines.
19526463 Investigations of the posttranslational mechanism of arsenite-mediated downregulation of human cytochrome P4501A1 levels: the role of heme oxygenase-1.
19526221 2009 Heme oxygenase-1 microsatellite polymorphism and haplotypes are associated with the development of acute respiratory distress syndrome.
19522732 2009 Brain sterol dysregulation in sporadic AD and MCI: relationship to heme oxygenase-1.
19508729 2009 Heme oxygenase-1 and its metabolites affect pancreatic tumor growth in vivo.
19487598 2009 Heme oxygenase 1 determines atherosclerotic lesion progression into a vulnerable plaque.
19484149 2009 Suppression of annexin A11 in ovarian cancer: implications in chemoresistance.
19475336 2009 Genetic analysis of heme oxygenase-1 (HO-1) in German Parkinson's disease patients.
19457866 2009 Induction of the cytoprotective enzyme heme oxygenase-1 by statins is enhanced in vascular endothelium exposed to laminar shear stress and impaired by disturbed flow.
19457084 2009 The Parkinson disease-associated A30P mutation stabilizes alpha-synuclein against proteasomal degradation triggered by heme oxygenase-1 over-expression in human neuroblastoma cells.
19445907 2009 Curcumin upregulates transcription factor Nrf2, HO-1 expression and protects rat brains against focal ischemia.
19428335 2009 Heme oxygenase-1 induction modulates microsomal prostaglandin E synthase-1 expression and prostaglandin E(2) production in osteoarthritic chondrocytes.
19422386 2009 The carbon monoxide releasing molecule (CORM-3) inhibits expression of vascular cell adhesion molecule-1 and E-selectin independently of haem oxygenase-1 expression.
19399816 2009 Cellular mRNA expressions of anti-oxidant factors in the blood of preeclamptic women.
19389234 2009 Genetic variants of the promoter of the heme oxygenase-1 gene and their influence on cardiovascular disease (the Ludwigshafen Risk and Cardiovascular Health study).
19371606 2009 Induction of heme oxygenase 1 by arsenite inhibits cytokine-induced monocyte adhesion to human endothelial cells.
19360326 2009 Sevoflurane and isoflurane decrease TNF-alpha-induced gene expression in human monocytic THP-1 cells: potential role of intracellular IkappaBalpha regulation.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19325051 2009 The protective role of HO-1 and its generated products (CO, bilirubin, and Fe) in ethanol-induced human hepatocyte damage.
19303319 2009 HO-1 and VEGF gene expressions are time dependant during exposure to welding fumes.
19289500 2009 Analysis of nitric oxide-stabilized mRNAs in human fibroblasts reveals HuR-dependent heme oxygenase 1 upregulation.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19255829 2009 The role of heme oxygenase-1 in systemic-onset juvenile idiopathic arthritis.
19255063 2009 Oxidative stress-related genotypes, fruit and vegetable consumption and breast cancer risk.
19250338 2009 HO-1-mediated macroautophagy: a mechanism for unregulated iron deposition in aging and degenerating neural tissues.
19246912 2009 No genetic association between polymorphisms of heme oxygenase 1 and 2 and Alzheimer's disease in a Japanese population.
19243105 2009 The orbital ground state of the azide-substrate complex of human heme oxygenase is an indicator of distal H-bonding: implications for the enzyme mechanism.
19243019 2009 Association of polymorphisms in four bilirubin metabolism genes with serum bilirubin in three Asian populations.
19238116 2009 Common variants of four bilirubin metabolism genes and their association with serum bilirubin and coronary artery disease in Chinese Han population.
19236506 2009 Haeme oxygenase-1 promoter polymorphism is an independent prognostic marker of gastrointestinal stromal tumour.
19194559 2009 The heme oxygenase-1 genotype is a risk factor to renal impairment of IgA nephropathy at diagnosis, which is a strong predictor of mortality.
19165391 2009 Iron metabolism genes, low-level lead exposure, and QT interval.
19133325 2009 Fatty acid transduction of nitric oxide signaling: nitrolinoleic acid mediates protective effects through regulation of the ERK pathway.
19129475 2009 Heme oxygenase-1 contributes to an alternative macrophage activation profile induced by apoptotic cell supernatants.
19122175 2009 Induction of prostacyclin by steady laminar shear stress suppresses tumor necrosis factor-alpha biosynthesis via heme oxygenase-1 in human endothelial cells.
19120903 2008 Increased intestinal expression of heme oxygenase-1 and its localization in patients with ulcerative colitis.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18983509 2009 15-deoxy-Delta12,14 prostaglandin J2-induced heme oxygenase-1 in megakaryocytes regulates thrombopoiesis.
18981090 2008 Lipopolysaccharide-induced expression of NAD(P)H:quinone oxidoreductase 1 and heme oxygenase-1 protects against excessive inflammatory responses in human monocytes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18975324 2008 HMOX1 promoter polymorphism modulates the relationship between disease activity and joint damage in rheumatoid arthritis.
18957281 2008 Prostaglandin D2 induces heme oxygenase-1 mRNA expression through the DP2 receptor.
18930811 2008 Severe oxidative damage in multiple sclerosis lesions coincides with enhanced antioxidant enzyme expression.