Property Summary

Ligand Count 1
NCBI Gene PubMed Count 898
PubMed Score 6181.33
PubTator Score 2639.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Colitis 54 3.407 1.7
Obesity 678 3.382 1.7
Gastroparesis 22 3.273 1.6
Asthma 385 3.182 1.6
Acute kidney injury 70 0.0 0.0
Adrenoleukodystrophy 29 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Anemia, Hemolytic 55 0.0 0.0
Blood Coagulation Disorders 42 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Cardiomegaly 116 0.0 0.0
Carotid Artery Diseases 11 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Coronary artery disease 268 0.0 0.0
Dermatitis, Contact 71 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic Angiopathies 16 0.0 0.0
Drug-Related Side Effects and Adverse Reactions 62 0.0 0.0
Fibrosis 44 0.0 0.0
Growth Disorders 35 0.0 0.0
Heart failure 162 0.0 0.0
Heme Oxygenase 1 Deficiency 1 0.0 0.0
Hemolysis 6 0.0 0.0
Hepatitis 67 0.0 0.0
Hepatorenal syndrome 6 0.0 0.0
Hyperinsulinism 133 0.0 0.0
Hyperplasia 27 0.0 0.0
Hypertension 396 0.0 0.0
Inflammation 120 0.0 0.0
Insulin Resistance 72 0.0 0.0
Iron Metabolism Disorders 5 0.0 0.0
Ischemia 28 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
Learning Disorders 29 0.0 0.0
Leishmaniasis, Visceral 13 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver diseases 87 0.0 0.0
Liver neoplasms 130 0.0 0.0
Lung Injury 20 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Mammary Neoplasms, Experimental 154 0.0 0.0
Mastocytosis, Systemic 2 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neurodegenerative Diseases 38 0.0 0.0
Pancreatic Diseases 8 0.0 0.0
Parkinson Disease 64 0.0 0.0
Pneumonia 174 0.0 0.0
Pre-Eclampsia 68 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Pulmonary Disease, Chronic Obstructive 31 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Pulmonary emphysema 48 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Retinal Diseases 55 0.0 0.0
SPINOCEREBELLAR ATAXIA 17 9 0.0 0.0
Status Epilepticus 98 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Thrombosis 46 0.0 0.0
Vascular System Injuries 9 0.0 0.0
Wounds and Injuries 18 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
COPD 118
Congestive heart failure 113

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease -1.200 2.8e-02
acute quadriplegic myopathy 1.156 3.6e-05
adult high grade glioma 1.300 2.0e-02
aldosterone-producing adenoma -1.283 3.5e-02
Astrocytoma, Pilocytic 1.300 4.4e-04
Breast cancer 1.400 7.9e-04
cystic fibrosis 1.682 1.3e-06
ependymoma 1.100 5.1e-03
glioblastoma 1.800 2.5e-04
interstitial cystitis 1.600 3.3e-03
lung cancer -1.200 5.5e-04
lung carcinoma -1.200 2.5e-13
malignant mesothelioma -2.600 3.7e-08
non-small cell lung cancer -1.621 4.3e-10
ovarian cancer -1.200 7.5e-05
pancreatic ductal adenocarcinoma liver m... -2.163 3.1e-03
psoriasis 1.400 1.4e-07
subependymal giant cell astrocytoma 2.408 8.1e-03
ulcerative colitis -1.700 9.2e-06

Protein-protein Interaction (3)

PDB (25)

Gene RIF (929)

AA Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE      1 - 70
SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGD     71 - 140
LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN    141 - 210
IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVAT    211 - 280
VAVGLYAM                                                                  281 - 288
//

Text Mined References (903)

PMID Year Title