Property Summary

NCBI Gene PubMed Count 71
PubMed Score 193.83
PubTator Score 154.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
pancreatic cancer 1.600 2.9e-05
malignant mesothelioma 1.900 5.5e-07
esophageal adenocarcinoma 1.200 2.0e-02
glioblastoma 3.000 3.5e-05
posterior fossa group A ependymoma 1.900 8.8e-07
sonic hedgehog group medulloblastoma 3.100 9.3e-09
atypical teratoid / rhabdoid tumor 3.300 5.8e-10
medulloblastoma, large-cell 3.600 7.6e-08
primitive neuroectodermal tumor 3.300 2.7e-06
Atopic dermatitis 2.100 1.8e-04
adrenocortical carcinoma 3.189 1.2e-05
non-small cell lung cancer 2.658 1.4e-29
intraductal papillary-mucinous carcinoma... 3.700 3.1e-04
intraductal papillary-mucinous neoplasm ... 4.600 1.4e-03
lung cancer 3.200 1.7e-06
colon cancer 1.100 1.5e-02
breast carcinoma 1.700 3.4e-06
Breast cancer 3.000 3.3e-23
interstitial cystitis 1.600 9.4e-03
lung adenocarcinoma 1.120 6.1e-04
pediatric high grade glioma 2.800 1.2e-06
primary Sjogren syndrome 1.600 1.1e-04
pancreatic carcinoma 1.300 2.8e-02
psoriasis 1.700 9.8e-64
nasopharyngeal carcinoma 1.500 4.1e-04
Endometriosis 1.370 1.1e-02
ductal carcinoma in situ 2.800 8.9e-04
invasive ductal carcinoma 3.000 3.6e-04
ulcerative colitis 1.300 4.1e-04
ovarian cancer 2.500 6.5e-05

Gene RIF (52)

PMID Text
26825774 The present study suggests that RHAMM is a novel beta-catenin intracellular binding partner, protecting beta-catenin from degradation and supporting the nuclear translocation of this key cellular mediator
26351067 RHAMM expression identifies an aggressive subpopulation of tumor budding cells and is an independent adverse prognostic factor for colorectal cancer patients.
26247678 In ocular TM cells, our data suggests that the most important determinant of HA cable formation appears to be the ratio of HA chains produced by the different HAS genes.
25830658 a causative link between altered function of AURKA-HMMR-TPX2-TUBG1 and breast carcinogenesis in BRCA1/2 mutation carriers
25731190 RHAMM might be a promising marker to identify early stage (nodal negative) patients at risk for dismal survival, who may benefit from specific adjuvant therapies.
25081535 analysis of the role of growth factors in Hyaluronan/RHAMM interactions in mesenchymal tumor pathogenesis [review]
25042645 stimulation of the E2F1-RHAMM axis in aggressive cancer cells is of high clinical significance
24966934 Case Report: identify patient with cervical cancer expressing three HMMR mRNA variants.
24916930 RHAMM may be implicated in severe ocular surface inflammation affecting the upper tarsal conjunctiva.
24875404 Identify RHAMM as a critical regulator of TPX2 location/ Aurora kinase A signaling and suggest that RHAMM ensures bipolar spindle assembly and mitotic progression through the integration of biochemical and structural pathways.
24710409 HMMR overexpression promotes GSC self-renewal.
24367099 RHAMM transcription is regulated via YAP in a pathway involving mevalonate and Hippo that modulates breast cancer cell motility
24069434 RHAMM plays a crucial role in mediating progression of muscle-invasive bladder cancer and recommends RHAMM for further evaluation as a prognostic marker or therapeutic target in bladder cancer therapy.
23382057 Suggest that detection of upregulated RHAMM expression in an ossifying fibroma assists with differential diagnosis and has a key role in elucidation of its pathophysiology.
23328114 Data indicate that the sensitivity of cell-lines with amplification of AURKA depends upon the activity of the kinase, which correlates with the expression of the regulatory gene products TPX2 and HMMR/RHAMM.
23166824 Hyaluronan (HA) interacting proteins RHAMM and hyaluronidase impact prostate cancer cell behavior and invadopodia formation in 3D HA-based hydrogels.
22532518 RHAMM does not fulfill the criteria of an ideal target antigen for immunotherapy of acute myeloid leukemia.
22371883 TCR-transgenic lymphocytes specific for HMMR/Rhamm limit tumor outgrowth in vivo.
22110403 study depicts a molecular mechanism involving BRCA1 and RHAMM that regulates apicobasal polarity and, when perturbed, may increase risk of breast cancer
22095138 Hyaluronan receptors in the human ocular surface: a descriptive and comparative study of RHAMM and CD44 in tissues, cell lines and freshly collected samples.
21914806 RHAMM/HA interaction regulates fibrosarcoma cell adhesion via the activation of FAK and ERK1/2 signaling pathways
21435222 tumor expression can be used as a prognostic marker of gastric cancer
21274712 RHAMM not only represents a promising leukemia-associated antigens with specific T-cell responses in acute myeloid leukemia but, if assessed in situ on blasts, also a probable prognostic factor
20956971 study reports the new machinery by which RHAMM/ERK interaction induces the proliferative activity of cementifying fibroma cells via a specific signaling pathway through the CD44-EGFR axis
20849445 Nodular basal cell carcinoma is associated with increased levels of hyaluronic acid concomitant with upregulation of gene expression of HAS3, HYAL3 and RHAMM, when compared with normal adjacent skin.
20619784 RHAMM regulates the ciliary differentiation-promoting effect of retinoic acid on respiratory epithelial cells.
19857547 coexpression of any of the CD44v with the receptor for hyaluronic acid-mediated motility (RHAMM, CD168) identifies a subgroup of DLBCL patients with a very poor prognosis, independent of the International Prognostic Index
19724689 RHAMM (CD168) is overexpressed at the protein level and may constitute an immunogenic antigen in advanced prostate cancer disease.
19580345 maintained expression and even up-regulation of some (PNPT1, PMPCB, HMMR/RHAMM, BSG and ERCC1) tumor associated antigens in CD40-activated leukemic cells.
19424574 Overexpression of the receptor for hyaluronan-mediated motility is associated with oral squamous cell carcinomas.
19212667 We therefore investigated the expression and immunogenicity of two tumor-associated antigens (TAA) the receptor for hyaluronic acid mediated motility (RHAMM) and carboanhydrase IX (G250/CAIX) in HNSCC patients.
19148505 A significant association was found between the mRNA expression levels of TPX and RHAMM in salivary gland carcinomas
19092852 Higher RHAMM expression in high-risk CLL patients, as well as in the advanced stages of the disease was associated with a significantly shorter median treatment-free survival. Stimulation with CD40L enhanced RHAMM expression in CLL.
19064580 The reported association between common snps in HMMR and breast cancer risk is likely to be a false positive association.
19064580 Observational study of gene-disease association. (HuGE Navigator)
19001852 REVIEW. p53 represses RHAMM and CD44 expression
18971636 p53-dependent downregulation is consistent with an oncogenic function of RHAMM and the recently reported tumor-suppressive function of CD44 transcriptional repression by p53.
18559599 The combined phenotype of RHAMM and p21 expression is an invaluable independent prognostic immunohistochemical profile in microsatellite instability-high colorectal cancer.
18425326 Results suggested that in oral squamous cell carcinoma RHAMM expression may be correlated with tumor aggressiveness.
18354082 The unconventional export of proteins such as RHAMM is a novel process that modifies the roles of tumor suppressors and promoters, such as BRCA1 and CD44, and might provide new targets for therapeutic intervention.
18174258 Androgen receptor regulates CD168 expression and signaling in prostate cancer
17978170 RHAMM-R3 peptide vaccination induced both immunologic and clinical responses, and therefore RHAMM constitutes a promising target for further immunotherapeutic approaches
17922014 Overexpression of HMMR is associated with breast cancer
17872502 RHAMM is expressed in embryhonic stem cells (ESC) and has an important role in maintenance of ESC pluripotency and proliferation.
17395888 These data suggest that high molecular form hyaluronan is broken down by reactive oxygen species to form low-molecular-weight fragments that signal via RHAMM and RON to stimulate beat frequency.
17392272 an effect of CD44 on tumor cell motility may depend in part on its ability to partner with additional proteins, such as cell surface Rhamm.
17157168 RHAMM/CD168 R3-peptide (ILSLELMKL)-specific T-cell responses in chronic myeloid leukemia [CML] patients were demonstrated; vaccination strategies inducing such RHAMM-R3-directed effector T cells might enhance specific immune responses against CML cells.
15809329 The overall results suggest that IHABP regulates the subcelluar localization of Bach1 in order to fine-tune transactivation of Bach1 target genes such as heme oxygenase-1.
15705883 Augmentation of RHAMM expression within human cancers, including myeloma, can directly affect centrosomal structure and spindle integrity and potentially modulate apoptotic and cell cycle progression pathways.
12712331 Increased RHAMM expression may enhance and improve the invasion and metastasis of endometrial carcinomas
12225794 RHAMM is an immunogenic antigen expressed in leukemias and solid tumors and might be a potential target structure for cellular immunotherapies and antibody therapies. RHAMM is not expressed in normal tissues except for testis, placenta, thymus.
11716065 Hyaluronate receptors mediate glioma cell migration and proliferation. The expression of the HA-receptors, CD44, and RHAMM, is virtually ubiquitous amongst glioma cell lines, and glioma tumor specimens.

AA Sequence

MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVK      1 - 70
SSESKESQKNDKDLKILEKEIRVLLQERGAQDRRIQDLETELEKMEARLNAALREKTSLSANNATLEKQL     71 - 140
IELTRTNELLKSKFSENGNQKNLRILSLELMKLRNKRETKMRGMMAKQEGMEMKLQVTQRSLEESQGKIA    141 - 210
QLEGKLVSIEKEKIDEKSETEKLLEYIEEISCASDQVEKYKLDIAQLEENLKEKNDEILSLKQSLEENIV    211 - 280
ILSKQVEDLNVKCQLLEKEKEDHVNRNREHNENLNAEMQNLKQKFILEQQEREKLQQKELQIDSLLQQEK    281 - 350
ELSSSLHQKLCSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKL    351 - 420
KGKEAELEKSSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKAAKAGKN    421 - 490
AEDVQHQILATESSNQEYVRMLLDLQTKSALKETEIKEITVSFLQKITDLQNQLKQQEEDFRKQLEDEEG    491 - 560
RKAEKENTTAELTEEINKWRLLYEELYNKTKPFQLQLDAFEVEKQALLNEHGAAQEQLNKIRDSYAKLLG    561 - 630
HQNLKQKIKHVVKLKDENSQLKSEVSKLRCQLAKKKQSETKLQEELNKVLGIKHFDPSKAFHHESKENFA    631 - 700
LKTPLKEGNTNCYRAPMECQESWK                                                  701 - 724
//

Text Mined References (77)

PMID Year Title
26825774 2016 Receptor for hyaluronic acid- mediated motility (RHAMM) regulates HT1080 fibrosarcoma cell proliferation via a ?-catenin/c-myc signaling axis.
26351067 2015 Expression of the hyaluronan-mediated motility receptor RHAMM in tumor budding cells identifies aggressive colorectal cancers.
26247678 2015 Hyaluronan cable formation by ocular trabecular meshwork cells.
25830658 2015 Assessing associations between the AURKA-HMMR-TPX2-TUBG1 functional module and breast cancer risk in BRCA1/2 mutation carriers.
25731190 2015 Receptor for hyaluronic acid-mediated motility (RHAMM, CD168) expression is prognostically important in both nodal negative and nodal positive large cell lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25081535 2014 Hyaluronan/RHAMM interactions in mesenchymal tumor pathogenesis: role of growth factors.
25042645 2014 Association of RHAMM with E2F1 promotes tumour cell extravasation by transcriptional up-regulation of fibronectin.
24966934 2014 A case of cervical cancer expressed three mRNA variant of Hyaluronan-mediated motility receptor.
24916930 2014 CD44 and RHAMM hyaluronan receptors in human ocular surface inflammation.
24875404 2014 Spatial regulation of Aurora A activity during mitotic spindle assembly requires RHAMM to correctly localize TPX2.
24710409 2014 HMMR maintains the stemness and tumorigenicity of glioblastoma stem-like cells.
24367099 2014 Interplay of mevalonate and Hippo pathways regulates RHAMM transcription via YAP to modulate breast cancer cell motility.
24069434 2013 The impact of the receptor of hyaluronan-mediated motility (RHAMM) on human urothelial transitional cell cancer of the bladder.
23382057 2013 Expression of receptor for hyaluronan-mediated motility (RHAMM) in ossifying fibromas.
23328114 2013 Genomic imbalance of HMMR/RHAMM regulates the sensitivity and response of malignant peripheral nerve sheath tumour cells to aurora kinase inhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166824 2012 Hyaluronan (HA) interacting proteins RHAMM and hyaluronidase impact prostate cancer cell behavior and invadopodia formation in 3D HA-based hydrogels.
22532518 2012 RHAMM/HMMR (CD168) is not an ideal target antigen for immunotherapy of acute myeloid leukemia.
22371883 2012 TCR-transgenic lymphocytes specific for HMMR/Rhamm limit tumor outgrowth in vivo.
22110403 2011 Interplay between BRCA1 and RHAMM regulates epithelial apicobasal polarization and may influence risk of breast cancer.
22095138 2012 Hyaluronan receptors in the human ocular surface: a descriptive and comparative study of RHAMM and CD44 in tissues, cell lines and freshly collected samples.
21914806 2011 Role of receptor for hyaluronic acid-mediated motility (RHAMM) in low molecular weight hyaluronan (LMWHA)-mediated fibrosarcoma cell adhesion.
21435222 2011 Prognostic impact of CD168 expression in gastric cancer.
21274712 2011 In situ RHAMM protein expression in acute myeloid leukemia blasts suggests poor overall survival.
21269460 2011 Initial characterization of the human central proteome.
20956971 2011 RHAMM/ERK interaction induces proliferative activities of cementifying fibroma cells through a mechanism based on the CD44-EGFR.
20849445 2011 Nodular basal cell carcinoma is associated with increased hyaluronan homeostasis.
20619784 2010 Regulation of ciliary differentiation of human respiratory epithelial cells by the receptor for hyaluronan-mediated motility on hyaluronan-based biomaterials.
19946888 2010 Defining the membrane proteome of NK cells.
19857547 2010 Coexpression of CD44 variant isoforms and receptor for hyaluronic acid-mediated motility (RHAMM, CD168) is an International Prognostic Index and C-MYC gene status-independent predictor of poor outcome in diffuse large B-cell lymphomas.
19724689 2009 RHAMM (CD168) is overexpressed at the protein level and may constitute an immunogenic antigen in advanced prostate cancer disease.
19580345 2009 Acute lymphoblastic leukemia-derived dendritic cells express tumor associated antigens: PNPT1, PMPCB, RHAMM, BSG and ERCC1.
19424574 2009 Overexpression of the receptor for hyaluronan-mediated motility, correlates with expression of microtubule-associated protein in human oral squamous cell carcinomas.
19212667 2009 The tumor antigens RHAMM and G250/CAIX are expressed in head and neck squamous cell carcinomas and elicit specific CD8+ T cell responses.
19148505 2009 Expression of TPX2 in salivary gland carcinomas.
19092852 2009 The candidate immunotherapeutical target, the receptor for hyaluronic acid-mediated motility, is associated with proliferation and shows prognostic value in B-cell chronic lymphocytic leukemia.
19064580 2008 Hyaluronan-mediated motility receptor gene single nucleotide polymorphisms and risk of breast cancer.
19001852 2008 Filling the mosaic of p53 actions: p53 represses RHAMM expression.
18971636 2008 RHAMM is differentially expressed in the cell cycle and downregulated by the tumor suppressor p53.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559599 2008 RHAMM, p21 combined phenotype identifies microsatellite instability-high colorectal cancers with a highly adverse prognosis.
18425326 2008 Hyaluronan-mediated motility: a target in oral squamous cell carcinoma.
18354082 2008 Cell-surface and mitotic-spindle RHAMM: moonlighting or dual oncogenic functions?
18174258 2008 Androgen receptor regulates CD168 expression and signaling in prostate cancer.
17978170 2008 RHAMM-R3 peptide vaccination in patients with acute myeloid leukemia, myelodysplastic syndrome, and multiple myeloma elicits immunologic and clinical responses.
17922014 2007 Network modeling links breast cancer susceptibility and centrosome dysfunction.
17872502 2007 Putative role of hyaluronan and its related genes, HAS2 and RHAMM, in human early preimplantation embryogenesis and embryonic stem cell characterization.
17395888 2007 Apical oxidative hyaluronan degradation stimulates airway ciliary beating via RHAMM and RON.
17392272 2007 The hyaluronan receptors CD44 and Rhamm (CD168) form complexes with ERK1,2 that sustain high basal motility in breast cancer cells.
17157168 2006 Chronic myeloid leukemia cells express tumor-associated antigens eliciting specific CD8+ T-cell responses and are lacking costimulatory molecules.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16112646 2005 Humoral detection of leukaemia-associated antigens in presentation acute myeloid leukaemia.
15809329 2005 Dynamic cytoplasmic anchoring of the transcription factor Bach1 by intracellular hyaluronic acid binding protein IHABP.
15705883 2005 Receptor for hyaluronan-mediated motility correlates with centrosome abnormalities in multiple myeloma and maintains mitotic integrity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12939665 2003 CD44 mediates polymorphonuclear leukocyte motility on hyaluronan.
12808028 2003 RHAMM is a centrosomal protein that interacts with dynein and maintains spindle pole stability.
12712331 2003 Expression of the hyaluronan receptor RHAMM in endometrial carcinomas suggests a role in tumour progression and metastasis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12225794 2002 Receptor for hyaluronan acid-mediated motility (RHAMM) is a new immunogenic leukemia-associated antigen in acute and chronic myeloid leukemia.
11716065 2001 Hyaluronate receptors mediating glioma cell migration and proliferation.
11448954 2001 Differential involvement of the hyaluronan (HA) receptors CD44 and receptor for HA-mediated motility in endothelial cell function and angiogenesis.
11433424 2001 Subcellular distribution, calmodulin interaction, and mitochondrial association of the hyaluronan-binding protein RHAMM in rat brain.
11403955 2001 Sequence, protein expression and extracellular-regulated kinase association of the hyaladherin RHAMM (receptor for hyaluronan mediated motility) in PC12 cells.
10882722 2000 Differences in hyaluronic acid-mediated functions and signaling in arterial, microvessel, and vein-derived human endothelial cells.
10547355 1999 The intracellular hyaluronan receptor RHAMM/IHABP interacts with microtubules and actin filaments.
10216086 1999 Potential role for hyaluronan and the hyaluronan receptor RHAMM in mobilization and trafficking of hematopoietic progenitor cells.
9601098 1998 The human hyaluronan receptor RHAMM is expressed as an intracellular protein in breast cancer cells.
8890751 1996 The characterization of a human RHAMM cDNA: conservation of the hyaluronan-binding domains.
8595891 1995 The human and mouse receptors for hyaluronan-mediated motility, RHAMM, genes (HMMR) map to human chromosome 5q33.2-qter and mouse chromosome 11.
7683315 1993 Regulated expression of a receptor for hyaluronan-mediated motility on human thymocytes and T cells.
7541721 1995 Overexpression of the hyaluronan receptor RHAMM is transforming and is also required for H-ras transformation.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.