Property Summary

NCBI Gene PubMed Count 28
PubMed Score 31.36
PubTator Score 25.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.700 2.0e-04
osteosarcoma 1.264 9.1e-03
cystic fibrosis 1.783 2.0e-05
medulloblastoma, large-cell 1.600 2.1e-02
lung cancer -1.400 8.9e-04
active ulcerative colitis -1.086 1.1e-02
group 3 medulloblastoma 1.300 1.7e-02

Gene RIF (19)

PMID Text
26548724 NSBP1 was highly expressed in NSCLC cells. NSBP1 siRNA knockdown suppressed NSCLC cell proliferation and invasion. miR326 has a putative binding site in the NSBP1 3'UTR. NSBP1 overexpression abolished miR326 inhibition of cyclin B1 and MMP9 expression.
26394192 Decreased miR-340 expression may contribute to the development and progression of prostate cancer through a mechanism that involves HMGN5.
26315299 HMGN5 overexpression is correlated with advanced pathological grade and poorer prognosis in meningiomas
26290438 Our data first time identified miR-186 as the upstream regulator of NSBP1
25796505 High HMGN5 expression is associated with urothelial bladder cancer.
25572120 HMGN5 is an oncogene and plays an important role in prostate cancer tumorigenesis and progression. the level of HMGN5 may be used as a biomarker to predict the patients that would benefit from gemcitabine treatment.
25315189 HMGN5 plays an oncogenic role in human breast cancer by inhibiting cell proliferation and invasion, and activating apoptosis, which could be exploited as a target for therapy in human breast cancer.
25307178 HMGN5 knockdown sensitizes prostate cancer cells to ionizing radiation
24687550 HMGN5 plays oncogenic role in osteosarcoma by promoting cell proliferation and invasion, and could be exploited as a target for therapy in osteosarcoma.
24664583 HMGN5 is a critical factor in the development of chemoresistance through regulating autophagy, and it offers a novel target for improving osteosarcoma therapy.
23673662 Data indicate that cells lacking either high mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2alpha (LAP2alpha) showed that loss of either protein affects the genome-wide distribution of the remaining partner.
22994738 HMGN5 silencing to significantly inhibit A549 and H1299 cell proliferation.
22504871 HMGN5 may be a potential molecular target with therapeutic relevance for the treatment of prostate cancer.
22420896 NSBP1 plays oncogenic role in clear cell renal cell carcinoma (ccRCC) by promoting cell proliferation and invasion.
21695596 these results suggest that NSBP1 promotes the viability of bladder cancer cells through increased cell proliferation
21518955 HMGN5 has a highly disordered structure, binds dynamically to nucleosome core particles, modulates the binding of H1 to chromatin, reduces the compaction of the chromatin fiber, and affects transcription.
21373965 The data of study suggested that HMGN5 may play a critical role in the development of gliomas.
20531280 A positive correlation was observed between NSBP1 expression and cell proliferation and apoptosis in DU145 cells.
20123071 The structure of the HMGN5 gene and the known properties of the HMGN5 protein, are described.

AA Sequence

MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEA      1 - 70
VVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVKNEEEDQKEDEEDQNEE     71 - 140
KGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGEDGKGNGEDGKEKGEDEKEEEDRKETGDGKE    141 - 210
NEDGKEKGDKKEGKDVKVKEDEKEREDGKEDEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQS    211 - 280
IV                                                                        281 - 282
//

Text Mined References (36)

PMID Year Title
26548724 2016 Suppression of nucleosome-binding protein 1 by miR-326 impedes cell proliferation and invasion in non-small cell lung cancer cells.
26394192 2016 microRNA-340 Suppresses Tumorigenic Potential of Prostate Cancer Cells by Targeting High-Mobility Group Nucleosome-Binding Domain 5.
26315299 2015 HMGN5 blockade by siRNA enhances apoptosis, suppresses invasion and increases chemosensitivity to temozolomide in meningiomas.
26290438 2015 MiR-186 suppresses the growth and metastasis of bladder cancer by targeting NSBP1.
25796505 2015 Knockdown of HMGN5 suppresses the viability and invasion of human urothelial bladder cancer 5637 cells in vitro and in vivo.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25572120 2015 Expression of oncogenic HMGN5 increases the sensitivity of prostate cancer cells to gemcitabine.
25315189 2015 The high-mobility group nucleosome-binding domain 5 is highly expressed in breast cancer and promotes the proliferation and invasion of breast cancer cells.
25307178 2015 HMGN5 knockdown sensitizes prostate cancer cells to ionizing radiation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24687550 2014 The expression and clinical significance of high mobility group nucleosome binding domain 5 in human osteosarcoma.
24664583 2014 High-mobility group nucleosome-binding domain 5 increases drug resistance in osteosarcoma through upregulating autophagy.
23673662 2013 High mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2? (LAP2?) interact and reciprocally affect their genome-wide chromatin organization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22994738 2012 Knockdown of HMGN5 expression by RNA interference induces cell cycle arrest in human lung cancer cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22504871 2012 Small interfering RNA targeting HMGN5 induces apoptosis via modulation of a mitochondrial pathway and Bcl-2 family proteins in prostate cancer cells.
22420896 2012 Knockdown of the nucleosome binding protein 1 inhibits the growth and invasion of clear cell renal cell carcinoma cells in vitro and in vivo.
21695596 2011 The nucleosome binding protein NSBP1 is highly expressed in human bladder cancer and promotes the proliferation and invasion of bladder cancer cells.
21518955 2011 Distinct properties of human HMGN5 reveal a rapidly evolving but functionally conserved nucleosome binding protein.
21373965 2011 HMGN5: a potential oncogene in gliomas.
21269460 2011 Initial characterization of the human central proteome.
20531280 2010 Downregulation of the nucleosome-binding protein 1 (NSBP1) gene can inhibit the in vitro and in vivo proliferation of prostate cancer cells.
20123071 HMGN5/NSBP1: a new member of the HMGN protein family that affects chromatin structure and function.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19748358 2009 The interaction of NSBP1/HMGN5 with nucleosomes in euchromatin counteracts linker histone-mediated chromatin compaction and modulates transcription.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11161810 2001 Characterization of a human gene encoding nucleosomal binding protein NSBP1.