Property Summary

NCBI Gene PubMed Count 8
PubMed Score 159.67
PubTator Score 56.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.253 4.1e-02
Multiple myeloma 1.943 1.0e-04
osteosarcoma 1.445 1.8e-06
ependymoma 1.100 7.3e-06
glioblastoma 1.100 7.4e-05
sonic hedgehog group medulloblastoma 1.300 1.5e-02
juvenile dermatomyositis 1.263 8.9e-11
primary pancreatic ductal adenocarcinoma 1.050 2.6e-02
lung cancer 1.100 6.2e-03
pediatric high grade glioma 1.100 6.1e-03
atypical teratoid/rhabdoid tumor 1.400 4.6e-04
pilocytic astrocytoma 1.200 2.6e-03
Breast cancer -1.100 3.5e-07
gastric carcinoma 1.100 3.5e-02
ovarian cancer -1.900 6.2e-05
dermatomyositis 1.300 9.2e-03

AA Sequence

MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPA      1 - 70
KNRDASTLQSQKAEGTGDAK                                                       71 - 90
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11410162 2001 HMGN4, a newly discovered nucleosome-binding protein encoded by an intronless gene.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.