1. Home
  2. Targets
  3. nucleic acid binding
  4. DNA binding protein
  5. chromatin/chromatin-binding protein
  6. High mobility group nucleosome-binding domain-containing protein 3

Tbio High mobility group nucleosome-binding domain-containing protein 3

Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function (By similarity).

The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. [provided by RefSeq, Jan 2016]

 Comments

Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.31
PubTator Score 8.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 3.3e-05
Multiple myeloma 1327 9.5e-04
chronic rhinosinusitis 512 3.4e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.690 9.5e-04
ovarian cancer -1.400 3.3e-05
chronic rhinosinusitis -1.043 3.4e-02

Synonym

Accession Q15651 B2RD37 Q5HYD3 Q7RTT0 Q969M5 Q9BZT7
Symbols TRIP7
PNAS-24
PNAS-25

Gene

HMGN3

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (7)

 GO Function (3)

 GO Component (3)

 GO Process (3)

 Compartment GO Term (20)

See all...

 MGI Phenotype (5)

 HCA RNA Cell Line (56)

See all...

Gene RIF (2)

PMID Text
21947420 The SNPs in the region of HMGN3 gene formed a tightly combined haplotype block in both Chinese and Caucasians. The results suggest that the genomic region containing HMGN3 gene may be associated with spine BS in Chinese.
19651901 loss of HMGN3 impairs glucose-stimulated insulin secretion and leads to a diabetic phenotype.

AA Sequence 

MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA      1 - 70
GKEGTAPSENGETKAEEAQKTESVDNEGE                                              71 - 99
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21947420 2012 Genome-wide association study identifies HMGN3 locus for spine bone size variation in Chinese.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19651901 2009 The nucleosome binding protein HMGN3 modulates the transcription profile of pancreatic beta cells and affects insulin secretion.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15082770 2004 Chromosomal proteins HMGN3a and HMGN3b regulate the expression of glycine transporter 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12033773 2002 Differential display RT-PCR analysis of enterovirus-71-infected rhabdomyosarcoma cells reveals mRNA expression responses of multiple human genes with known and novel functions.
11356838 2001 HMGN3a and HMGN3b, two protein isoforms with a tissue-specific expression pattern, expand the cellular repertoire of nucleosome-binding proteins.
7776974 1995 Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.