Property Summary

NCBI Gene PubMed Count 33
PubMed Score 192.29
PubTator Score 109.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (14)

PMID Text
27100087 RNA-seq evidence of biallelic expression of HMGN1 and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of HMGN1 is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.
26113410 HMGN1 can serve as a useful clinical parameter for evaluating disease progression and predicting the outcomes for early-stage patients with non-small cell lung cancer .
25472883 HIV-1 Tat specifically associates with HMGN1 promoter to upregulate HMGN1 expression in T cells
22393258 nucleosome binding protein HMGN1 as a new PCNA-interacting protein that enhances the binding of PCNA to chromatin
22184635 extracellular HMGN1 acts as a novel alarmin critical for LPS-induced development of innate and adaptive immune responses.
22009741 HMGN1 regulates the expression of methyl CpG-binding protein 2 (MECP2) in mouse and human, and affects the behavior of mice
21173166 HMGN1 is not randomly distributed throughout the genome. Instead, the protein preferentially localizes to DNase I hypersensitive (HS) sites, promoters, functional enhancers, and transcription factor binding sites.
19524541 HMGN1 (HMG14) and HMGN2 (HMG17) potently repress ATP-dependent chromatin remodeling by four different molecular motor proteins.
18287527 These studies demonstrate that the mode of binding of HMGNs to chromatin is cell cycle dependent.
17938209 These findings indicate that HMGN1 regulates the expression of particular genes via specific protein-protein interactions with transcription factors at target gene regulatory regions.
16729963 Five serine residues, i.e., Ser6, Ser7, Ser85, Ser88, and Ser98, in HMGN1 can be phosphorylated by the kinase in vitro, and Ser6, Ser7, and Ser85 were new sites among these five sites.
16253989 SWI/SNF functions independently of HMGN1
16061652 HMGN1 optimizes the cellular response to ionizing radiation and to other tumorigenic events; therefore, loss of this protein increases the tumor burden in mice.
15147216 Results show that four serine residues, i.e., Ser6, Ser85, Ser88, and Ser98, can be phosphorylated in high mobility group N1 (HMGN1).

AA Sequence

MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET      1 - 70
KEDLPAENGETKTEESPASDEAGEKEAKSD                                             71 - 100
//

Text Mined References (46)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
26113410 2015 High-mobility group nucleosome-binding protein 1 is a novel clinical biomarker in non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22393258 2012 The nucleosome binding protein HMGN1 interacts with PCNA and facilitates its binding to chromatin.
22184635 2012 High-mobility group nucleosome-binding protein 1 acts as an alarmin and is critical for lipopolysaccharide-induced immune responses.
22009741 2011 The chromatin-binding protein HMGN1 regulates the expression of methyl CpG-binding protein 2 (MECP2) and affects the behavior of mice.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21173166 2011 Genomic profiling of HMGN1 reveals an association with chromatin at regulatory regions.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19524541 2009 HMGN proteins act in opposition to ATP-dependent chromatin remodeling factors to restrict nucleosome mobility.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18993075 2008 Evidence for insertional RNA editing in humans.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18287527 2008 Cell cycle-dependent binding of HMGN proteins to chromatin.
17938209 2007 HMGN1 modulates estrogen-mediated transcriptional activation through interactions with specific DNA-binding transcription factors.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16729963 2006 Phosphorylation of human high mobility group N1 protein by protein kinase CK2.
16253989 2005 Effects of HMGN1 on chromatin structure and SWI/SNF-mediated chromatin remodeling.
16061652 2005 Increased tumorigenicity and sensitivity to ionizing radiation upon loss of chromosomal protein HMGN1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15147216 2004 Identification of novel in vivo phosphorylation sites in high mobility group N1 protein from the MCF-7 human breast cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12773393 2003 MSK2 and MSK1 mediate the mitogen- and stress-induced phosphorylation of histone H3 and HMG-14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12215538 2002 Mitotic phosphorylation of chromosomal protein HMGN1 inhibits nuclear import and promotes interaction with 14.3.3 proteins.
11438671 2001 Mitotic phosphorylation prevents the binding of HMGN proteins to chromatin.
10830953 2000 The DNA sequence of human chromosome 21.
10753971 2000 Acetylation of novel sites in the nucleosomal binding domain of chromosomal protein HMG-14 by p300 alters its interaction with nucleosomes.
10739259 2000 Phosphorylation and subcellular redistribution of high mobility group proteins 14 and 17, analyzed by mass spectrometry.
9852141 1998 Chromosomal proteins HMG-14 and HMG-17 are released from mitotic chromosomes and imported into the nucleus by active transport.
8534374 1995 Characterization of transgenic mice with an increased content of chromosomal protein HMG-14 in their chromatin.
8514795 1993 Aberrant expression of high mobility group chromosomal protein 14 affects cellular differentiation.
8047885 1994 Stimulation of RNA polymerase II elongation by chromosomal protein HMG-14.
7563062 1995 Homodimers of chromosomal proteins HMG-14 and HMG-17 in nucleosome cores.
4022776 1985 Histone H1 and HMG 14/17 are deposited nonrandomly in the nucleus.
3782107 1986 Chromosomal protein HMG-14. Complete human cDNA sequence and evidence for a multigene family.
2563381 1989 Chromosomal protein HMG-14. Identification, characterization, and chromosome localization of a functional gene from the large human multigene family.
2140193 1990 Chromosomal protein HMG-14 gene maps to the Down syndrome region of human chromosome 21 and is overexpressed in mouse trisomy 16.