Property Summary

NCBI Gene PubMed Count 17
PubMed Score 43.67
PubTator Score 17.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (6)

AA Sequence

MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSLCM      1 - 70
TVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAV     71 - 140
NWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDML    141 - 210
SEYPIVDGKLSIQCYLSALDRCYSVYCKKIHAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLL    211 - 280
NDFLNDQNRDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVY    281 - 350
GSLASVLAQYSPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAP    351 - 420
DVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIAT    421 - 490
EHIPSPAKKVPRLPATAAEPEAAVISNGEH                                            491 - 520
//

Text Mined References (26)

PMID Year Title