Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.56
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.000 2.7e-02
ependymoma -2.900 1.4e-02
oligodendroglioma -1.900 1.1e-13
glioblastoma -3.100 1.9e-05
group 4 medulloblastoma -2.500 5.6e-05
atypical teratoid / rhabdoid tumor -3.300 5.1e-10
medulloblastoma, large-cell -3.500 2.7e-07
primitive neuroectodermal tumor -1.700 4.2e-02
interstitial cystitis -1.400 1.2e-02
lung adenocarcinoma -1.300 3.2e-18
pediatric high grade glioma -2.700 2.0e-06
pilocytic astrocytoma -3.100 9.5e-10
subependymal giant cell astrocytoma -2.109 5.7e-03
Pick disease -1.200 3.8e-03
psoriasis -1.200 5.3e-18

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (3)

PMID Text
22865860 analysis of HMGCLL1 as an extramitochondrial human 3-hydroxy-3-methylglutaryl-CoA lyase and comparison with MHGCL
22847177 there are nine mature transcripts for the novel gene HMGCLL1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQTSLLTNLHCFQPDVSGFSVSLAGTVACIHWETSQ      1 - 70
LSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQMADHTEVMKGI     71 - 140
HQYPGVRYPVLTPNLQGFHHAVAAGATEISVFGAASESFSKKNINCSIEESMGKFEEVVKSARHMNIPAR    141 - 210
GYVSCALGCPYEGSITPQKVTEVSKRLYGMGCYEISLGDTIGVGTPGSMKRMLESVMKEIPPGALAVHCH    211 - 280
DTYGQALANILTALQMGINVVDSAVSGLGGCPYAKGASGNVATEDLIYMLNGLGLNTGVNLYKVMEAGDF    281 - 350
ICKAVNKTTNSKVAQASFNA                                                      351 - 370
//

Text Mined References (13)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22865860 2012 Identification and characterization of an extramitochondrial human 3-hydroxy-3-methylglutaryl-CoA lyase.
22847177 2012 Characterization of a novel HMG-CoA lyase enzyme with a dual location in endoplasmic reticulum and cytosol.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8440722 1993 3-Hydroxy-3-methylglutaryl coenzyme A lyase (HL). Cloning of human and chicken liver HL cDNAs and characterization of a mutation causing human HL deficiency.